Protein Family IF09550
Metagenome
Isolate
209
Members
74
Samples
187
Scaffolds
434.89
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_608812|Ga0466704_608812_777_2273
- Length
- 498 aa
- Sequence
- MTCFSCLRLSAKSIDLVSQILACRLVGVGEYLNNLAFICFMPFSLPKCEGNAMAMLRKCGARHMRRLLMDDLLRWKNRKNRRPLILRGARQVGKSWLLNEFGKTAFEDVMSINFENAPGLKETFDGDISPQRIIDLLGALYGKRIKPQKTLLIFDEVQEIPRALTALKYFAEAAPEYAVCCAGSLLGVALHSGTSFPVGKVDFLNLQPLDFEEFLLAGGESLLIEFVRGNGMRAIPKAIADKLTDYLKLYLIIGGMPAAVSSWFDTKDHSIVESAQRDILTTYENDFSKHTPKAIVPKLRYLWDSIPSQLAKENKKFIYGLVREGARARDFEEALLWLLDSGLLRKVGRVAKAASPLKAYEDXXXFKLYHLDVGLLRVMSELPPSAILEGPKVFEEFKGALTEQFVLSELAGKDFIRNVYYWTSNGTAEVDFIFADDQSIYPVEVKASENLRSRSLQAYRSRYAPRLAIRTSLSNLRLDGGLLNVPLFALFNLENYLK
Sample Types
Isolate
10.5%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.7%
Unclassified
32.9%
Kalotermitidae
17.8%
Termopsidae
4.1%
Rhinotermitidae
2.7%
Hodotermitidae
1.4%
Passalidae
1.4%
Taxonomy
Archaea
12
Bacteria
168
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 14 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 15 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 16 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 17 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 30 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 31 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 32 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 42 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 48 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 49 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 57 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 58 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 60 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 61 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 62 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 63 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 64 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 65 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 66 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 67 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 68 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 69 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 70 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 71 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 72 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 73 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 74 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_178619 | 3300042656 | Bacteria | 3701 |
| 2 | Ga0466706_028673 | 3300042599 | Bacteria | 25582 |
| 3 | Ga0466706_221683 | 3300042599 | Bacteria | 16996 |
| 4 | Ga0466707_314727 | 3300042601 | Bacteria | 2105 |
| 5 | Ga0466716_530278 | 3300042605 | Bacteria | 4304 |
| 6 | Ga0466721_100978 | 3300042608 | Bacteria | 228571 |
| 7 | Ga0466722_105694 | 3300042609 | Bacteria | 2172 |
| 8 | Ga0466698_273853 | 3300042610 | Unclassified | 1720 |
| 9 | Ga0123357_10095571 | 3300009784 | Bacteria | 3852 |
| 10 | Ga0123357_10096856 | 3300009784 | Bacteria | 3820 |
| 11 | Ga0123356_10110414 | 3300010049 | Bacteria | 2655 |
| 12 | Ga0123356_10461891 | 3300010049 | Unclassified | 1419 |
| 13 | Ga0123354_10275843 | 3300010882 | Unclassified | 1644 |
| 14 | Ga0264413_112857 | 3300024493 | Unclassified | 1610 |
| 15 | Ga0466690_325515 | 3300042590 | Bacteria | 3834 |
| 16 | Ga0466711_485222 | 3300042615 | Bacteria | 2029 |
| 17 | Ga0466715_109660 | 3300042616 | Bacteria | 4223 |
| 18 | Ga0466726_462787 | 3300042619 | Archaea | 2325 |
| 19 | Ga0466728_070262 | 3300042620 | Bacteria | 1745 |
| 20 | JGI24702J35022_10035655 | 3300002462 | Unclassified | 2661 |
| 21 | JGI24702J35022_10063308 | 3300002462 | Bacteria | 1981 |
| 22 | JGI24702J35022_10074732 | 3300002462 | Unclassified | 1830 |
| 23 | JGI24702J35022_10079070 | 3300002462 | Archaea | 1780 |
| 24 | Ga0068305_10023995 | 3300005083 | Unclassified | 4166 |
| 25 | Ga0123357_10000026 | 3300009784 | Bacteria | 128045 |
| 26 | Ga0466704_608812 | 3300042643 | Bacteria | 2945 |
| 27 | Ga0466708_092239 | 3300042652 | Bacteria | 3479 |
| 28 | Ga0466727_169006 | 3300042655 | Bacteria | 2607 |
| 29 | Ga0466705_349003 | 3300042612 | Bacteria | 11767 |
| 30 | Ga0466701_088523 | 3300042598 | Unclassified | 2229 |
| 31 | Ga0466706_230305 | 3300042599 | Archaea | 2480 |
| 32 | Ga0466700_294941 | 3300042600 | Bacteria | 1891 |
| 33 | Ga0466707_226106 | 3300042601 | Bacteria | 45923 |
| 34 | Ga0466713_037721 | 3300042602 | Bacteria | 42636 |
| 35 | Ga0466713_052610 | 3300042602 | Bacteria | 20946 |
| 36 | Ga0466722_249580 | 3300042609 | Bacteria | 2224 |
| 37 | Ga0466697_024218 | 3300042611 | Bacteria | 2018 |
| 38 | Ga0123357_10039852 | 3300009784 | Bacteria | 6396 |
| 39 | Ga0123357_10056388 | 3300009784 | Bacteria | 5284 |
| 40 | Ga0123355_10210487 | 3300009826 | Bacteria | 2819 |
| 41 | Ga0123355_10219155 | 3300009826 | Archaea | 2740 |
| 42 | Ga0123356_10210935 | 3300010049 | Bacteria | 1991 |
| 43 | Ga0123353_10012367 | 3300010167 | Bacteria | 12125 |
| 44 | Ga0123353_10184143 | 3300010167 | Bacteria | 3303 |
| 45 | Ga0415639_001789 | 3300038395 | Bacteria | 72751 |
| 46 | Ga0466711_425360 | 3300042615 | Bacteria | 14894 |
| 47 | Ga0466715_361307 | 3300042616 | Bacteria | 18941 |
| 48 | Ga0466723_311998 | 3300042618 | Unclassified | 2207 |
| 49 | Ga0466723_369006 | 3300042618 | Bacteria | 15939 |
| 50 | Ga0466729_133317 | 3300042621 | Unclassified | 4789 |
| 51 | Ga0466734_097414 | 3300042623 | Bacteria | 3194 |
| 52 | Ga0466735_213241 | 3300042624 | Bacteria | 1773 |
| 53 | Ga0466697_092988 | 3300042611 | Archaea | 2057 |
| 54 | Ga0466701_024180 | 3300042598 | Bacteria | 2051 |
| 55 | Ga0466706_239019 | 3300042599 | Unclassified | 2162 |
| 56 | Ga0466700_366289 | 3300042600 | Bacteria | 1767 |
| 57 | Ga0466707_194864 | 3300042601 | Bacteria | 2410 |
| 58 | Ga0466707_232450 | 3300042601 | Bacteria | 8601 |
| 59 | Ga0466707_396251 | 3300042601 | Bacteria | 6992 |
| 60 | Ga0466721_097985 | 3300042608 | Bacteria | 27262 |
| 61 | Ga0466721_280564 | 3300042608 | Unclassified | 1754 |
| 62 | Ga0123355_10061395 | 3300009826 | Bacteria | 6069 |
| 63 | Ga0123356_10000978 | 3300010049 | Bacteria | 31713 |
| 64 | Ga0123356_10174758 | 3300010049 | Unclassified | 2163 |
| 65 | Ga0123356_10192264 | 3300010049 | Bacteria | 2073 |
| 66 | Ga0123356_10263202 | 3300010049 | Bacteria | 1810 |
| 67 | Ga0123353_10092246 | 3300010167 | Bacteria | 4879 |
| 68 | Ga0123353_10312608 | 3300010167 | Bacteria | 2390 |
| 69 | Ga0466710_431334 | 3300042613 | Bacteria | 5432 |
| 70 | Ga0466711_293688 | 3300042615 | Bacteria | 10569 |
| 71 | Ga0466715_196071 | 3300042616 | Bacteria | 3573 |
| 72 | Ga0466715_380822 | 3300042616 | Bacteria | 1637 |
| 73 | JGI24702J35022_10017386 | 3300002462 | Bacteria | 3929 |
| 74 | JGI24705J35276_12221164 | 3300002504 | Bacteria | 2320 |
| 75 | Ga0123357_10001947 | 3300009784 | Bacteria | 22534 |
| 76 | Ga0466703_300625 | 3300042636 | Bacteria | 2687 |
| 77 | Ga0466708_057683 | 3300042652 | Bacteria | 13335 |
| 78 | Ga0466725_094805 | 3300042654 | Bacteria | 6072 |
| 79 | Ga0123355_10128474 | 3300009826 | Archaea | 3910 |
| 80 | Ga0123356_10033472 | 3300010049 | Bacteria | 4805 |
| 81 | Ga0123353_10005786 | 3300010167 | Bacteria | 16321 |
| 82 | Ga0123353_10218195 | 3300010167 | Bacteria | 2985 |
| 83 | Ga0123353_10360160 | 3300010167 | Archaea | 2186 |
| 84 | Ga0466656_183376 | 3300042550 | Bacteria | 1889 |
| 85 | Ga0466694_405291 | 3300042594 | Bacteria | 10333 |
| 86 | Ga0466696_078957 | 3300042596 | Unclassified | 1925 |
| 87 | Ga0466705_490117 | 3300042612 | Bacteria | 18099 |
| 88 | Ga0466715_508115 | 3300042616 | Bacteria | 18878 |
| 89 | Ga0466715_552884 | 3300042616 | Bacteria | 6361 |
| 90 | JGI24702J35022_10062455 | 3300002462 | Bacteria | 1995 |
| 91 | Ga0068305_10046751 | 3300005083 | Bacteria | 29879 |
| 92 | Ga0466731_142113 | 3300042622 | Bacteria | 2480 |
| 93 | Ga0466704_228126 | 3300042643 | Archaea | 2203 |
| 94 | Ga0466705_124126 | 3300042612 | Bacteria | 27175 |
| 95 | Ga0466701_102982 | 3300042598 | Bacteria | 4224 |
| 96 | Ga0466713_099914 | 3300042602 | Bacteria | 22310 |
| 97 | Ga0466714_065131 | 3300042603 | Bacteria | 171349 |
| 98 | Ga0466717_302903 | 3300042604 | Archaea | 1916 |
| 99 | Ga0466720_156324 | 3300042607 | Bacteria | 70548 |
| 100 | Ga0466721_022258 | 3300042608 | Bacteria | 6974 |
| 101 | Ga0466722_127330 | 3300042609 | Bacteria | 3305 |
| 102 | Ga0466697_053937 | 3300042611 | Unclassified | 4634 |
| 103 | Ga0123356_10182491 | 3300010049 | Bacteria | 2122 |
| 104 | Ga0123356_10237867 | 3300010049 | Bacteria | 1890 |
| 105 | Ga0123353_10000237 | 3300010167 | Bacteria | 69845 |
| 106 | Ga0123353_10021081 | 3300010167 | Bacteria | 9767 |
| 107 | Ga0123354_10171941 | 3300010882 | Bacteria | 2516 |
| 108 | Ga0466656_324362 | 3300042550 | Bacteria | 1970 |
| 109 | Ga0466694_273608 | 3300042594 | Bacteria | 1280 |
| 110 | Ga0466699_101483 | 3300042597 | Bacteria | 1515 |
| 111 | Ga0466701_010696 | 3300042598 | Bacteria | 3155 |
| 112 | Ga0466711_156819 | 3300042615 | Bacteria | 42889 |
| 113 | JGI24698J34947_10055460 | 3300002449 | Bacteria | 1974 |
| 114 | JGI24702J35022_10040388 | 3300002462 | Bacteria | 2488 |
| 115 | JGI24705J35276_12238739 | 3300002504 | Bacteria | 48451 |
| 116 | Ga0466703_284633 | 3300042636 | Bacteria | 3384 |
| 117 | Ga0466703_366442 | 3300042636 | Bacteria | 2089 |
| 118 | Ga0466725_317320 | 3300042654 | Bacteria | 1869 |
| 119 | Ga0466706_115959 | 3300042599 | Bacteria | 5210 |
| 120 | Ga0466706_151105 | 3300042599 | Bacteria | 6180 |
| 121 | Ga0466700_078425 | 3300042600 | Archaea | 1608 |
| 122 | Ga0466700_491888 | 3300042600 | Bacteria | 1185 |
| 123 | Ga0466716_120115 | 3300042605 | Bacteria | 3169 |
| 124 | Ga0123357_10246136 | 3300009784 | Bacteria | 1925 |
| 125 | Ga0123355_10015459 | 3300009826 | Bacteria | 11992 |
| 126 | Ga0123355_10051162 | 3300009826 | Bacteria | 6706 |
| 127 | Ga0123353_10000008 | 3300010167 | Bacteria | 264409 |
| 128 | Ga0466656_330106 | 3300042550 | Bacteria | 5051 |
| 129 | Ga0466690_061295 | 3300042590 | Unclassified | 1639 |
| 130 | Ga0466705_406463 | 3300042612 | Bacteria | 27717 |
| 131 | Ga0466711_299775 | 3300042615 | Bacteria | 11132 |
| 132 | Ga0466711_352154 | 3300042615 | Bacteria | 2260 |
| 133 | Ga0466711_479688 | 3300042615 | Bacteria | 3100 |
| 134 | Ga0466723_111617 | 3300042618 | Unclassified | 2054 |
| 135 | Ga0466726_400438 | 3300042619 | Bacteria | 4855 |
| 136 | JGI24702J35022_10065994 | 3300002462 | Bacteria | 1942 |
| 137 | Ga0072940_1054166 | 3300005200 | Bacteria | 3222 |
| 138 | Ga0466729_227291 | 3300042621 | Bacteria | 2008 |
| 139 | Ga0466706_013032 | 3300042599 | Bacteria | 25436 |
| 140 | Ga0466706_179358 | 3300042599 | Bacteria | 3947 |
| 141 | Ga0466707_409353 | 3300042601 | Unclassified | 10285 |
| 142 | Ga0466719_212239 | 3300042606 | Archaea | 1414 |
| 143 | Ga0123355_10026156 | 3300009826 | Bacteria | 9409 |
| 144 | Ga0123356_10003193 | 3300010049 | Bacteria | 17219 |
| 145 | Ga0123356_10013621 | 3300010049 | Bacteria | 7839 |
| 146 | Ga0123353_10096598 | 3300010167 | Bacteria | 4762 |
| 147 | Ga0123354_10000071 | 3300010882 | Bacteria | 76954 |
| 148 | Ga0123354_10065157 | 3300010882 | Bacteria | 5335 |
| 149 | Ga0123354_10065168 | 3300010882 | Unclassified | 5334 |
| 150 | Ga0123354_10138752 | 3300010882 | Bacteria | 3023 |
| 151 | Ga0123354_10218161 | 3300010882 | Bacteria | 2036 |
| 152 | Ga0466693_450060 | 3300042592 | Unclassified | 3782 |
| 153 | Ga0466718_097193 | 3300042617 | Bacteria | 6836 |
| 154 | Ga0466723_253032 | 3300042618 | Unclassified | 1660 |
| 155 | 2227555166 | 2225789004 | Bacteria | 14887 |
| 156 | JGI24702J35022_10100783 | 3300002462 | Bacteria | 1581 |
| 157 | JGI24705J35276_12238036 | 3300002504 | Bacteria | 15194 |
| 158 | JGI24696J40584_12958530 | 3300002834 | Bacteria | 4213 |
| 159 | Ga0072940_1070500 | 3300005200 | Bacteria | 5578 |
| 160 | Ga0123357_10000577 | 3300009784 | Bacteria | 36273 |
| 161 | Ga0466704_329372 | 3300042643 | Unclassified | 1800 |
| 162 | Ga0466727_345555 | 3300042655 | Bacteria | 7436 |
| 163 | Ga0466705_096121 | 3300042612 | Bacteria | 2764 |
| 164 | Ga0466705_279878 | 3300042612 | Bacteria | 2396 |
| 165 | Ga0466706_289324 | 3300042599 | Bacteria | 8218 |
| 166 | Ga0466707_048581 | 3300042601 | Bacteria | 5385 |
| 167 | Ga0466714_036550 | 3300042603 | Unclassified | 1802 |
| 168 | Ga0466722_008723 | 3300042609 | Bacteria | 1686 |
| 169 | Ga0123355_10012231 | 3300009826 | Bacteria | 13291 |
| 170 | Ga0123356_10026185 | 3300010049 | Bacteria | 5479 |
| 171 | Ga0123356_10471446 | 3300010049 | Unclassified | 1407 |
| 172 | Ga0123353_10096338 | 3300010167 | Bacteria | 4769 |
| 173 | Ga0123353_10140181 | 3300010167 | Unclassified | 3874 |
| 174 | Ga0123353_10295588 | 3300010167 | Unclassified | 2476 |
| 175 | Ga0123353_10613337 | 3300010167 | Bacteria | 1551 |
| 176 | Ga0123354_10082054 | 3300010882 | Bacteria | 4548 |
| 177 | Ga0415639_005633 | 3300038395 | Bacteria | 44118 |
| 178 | Ga0415639_007166 | 3300038395 | Archaea | 3409 |
| 179 | Ga0415639_033545 | 3300038395 | Bacteria | 2659 |
| 180 | JGI24702J35022_10002545 | 3300002462 | Bacteria | 11089 |
| 181 | JGI24702J35022_10056866 | 3300002462 | Unclassified | 2087 |
| 182 | JGI24696J40584_12961202 | 3300002834 | Bacteria | 11957 |
| 183 | Ga0466731_272939 | 3300042622 | Unclassified | 4105 |
| 184 | Ga0466735_189823 | 3300042624 | Bacteria | 1800 |
| 185 | Ga0466735_228356 | 3300042624 | Bacteria | 8705 |
| 186 | Ga0466709_037454 | 3300042648 | Unclassified | 1510 |
| 187 | Ga0466725_115711 | 3300042654 | Bacteria | 23801 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.