Protein Family IF09527

Metagenome Isolate
154 Members
23 Samples
153 Scaffolds
602.01 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_507127|Ga0466704_507127_551_2467
Length
638 aa
Sequence
MLLSNNNGEKTPWKGNDIMKQEKSQKKGMARLLELGARKKGLIVSSCVLAVISVAVSFAPFVAIYYIIRELVVHFADLGALDTAYIVRLGWLAAGSAVAAILLNFLALMCSHLAAFKTQYELKLEYAAHIASLPLGFHSANSTGKLRKIVDENIEKLEGFVAHQLPDMAGSFAMPVVTLIVLFVFDWRLGLASLVPIIAAYLIQMGAYGGDKSQKFIKLYQDSLEDLSNASVEYVRGISVVKAFNQTIFSFRKFHETITDYGRFVKAYTIAFEKFMAAFMVIINHVYVFLIPALILMAGGAEDYAQFALAAVFYIVFSFSLATPFTKLMYVSSLSTQVSDGIERMDNMLAVRPLPETKTPKTAVEYSVSFENVIFSYVSGEESETAALNGVSFTARQGEVTALVGPSGSGKSTIAHLIPRFYDVNEGAVKIGGADIRDMASEYLMSIVSFVFQDVFLFKQSVADNIRIGGKNASREQVIAAARAAQCHEFIEKLPQGYDTGIGSSGVHLSGGERQRIVIARAILKNAPILVLDEATAFADPENEQKIQHALSELMKNKTVIIIAHRLSTVRGADKILVVDRGKIVEEGRHETLVNANGRYSRMWEQYTGAMDWTLGGNPAARLARSGKETEVAANVRN

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 60.9%
Rhinotermitidae 13.0%
Termopsidae 8.7%
Passalidae 4.3%
Blaberidae 4.3%
Unclassified 4.3%
Formicidae 4.3%

🌳 Taxonomy

Archaea 1
Bacteria 148
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
2 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
3 2772190975 Treponema sp. RmG30 Isolate Blaberidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_177074 3300042612 Bacteria 9587
2 Ga0466705_307134 3300042612 Bacteria 9464
3 Ga0456237_0003562 3300041968 Bacteria 2519
4 Ga0466690_140755 3300042590 Bacteria 2272
5 Ga0466692_099995 3300042591 Bacteria 2416
6 Ga0466692_137651 3300042591 Bacteria 9251
7 Ga0466692_186688 3300042591 Bacteria 10206
8 Ga0466691_177368 3300042593 Bacteria 4115
9 Ga0466696_016054 3300042596 Bacteria 141586
10 Ga0466696_064731 3300042596 Bacteria 5210
11 Ga0466696_241539 3300042596 Bacteria 12197
12 Ga0466696_445148 3300042596 Bacteria 16635
13 Ga0466711_409535 3300042615 Bacteria 7635
14 Ga0466723_293113 3300042618 Bacteria 2663
15 Ga0466703_007911 3300042636 Bacteria 16645
16 Ga0466704_090552 3300042643 Bacteria 24637
17 Ga0466704_573814 3300042643 Bacteria 16325
18 Ga0466704_597245 3300042643 Bacteria 12322
19 Ga0466708_027996 3300042652 Bacteria 5652
20 Ga0466708_127939 3300042652 Bacteria 25157
21 Ga0466708_211906 3300042652 Bacteria 6300
22 Ga0466705_040965 3300042612 Bacteria 10488
23 Ga0466705_181551 3300042612 Bacteria 6248
24 Ga0466705_192326 3300042612 Unclassified 3929
25 Ga0466690_089426 3300042590 Unclassified 2844
26 Ga0466696_022893 3300042596 Bacteria 4428
27 Ga0466715_123647 3300042616 Bacteria 10127
28 Ga0466715_496937 3300042616 Bacteria 6875
29 Ga0466716_386144 3300042605 Bacteria 8728
30 Ga0466719_200895 3300042606 Bacteria 8595
31 IMNBL1DRAFT_c0000672 3300000062 Bacteria 27422
32 Ga0466703_106753 3300042636 Bacteria 4096
33 Ga0466704_297275 3300042643 Bacteria 20574
34 Ga0466704_525157 3300042643 Bacteria 16018
35 Ga0466708_330248 3300042652 Bacteria 3866
36 Ga0466705_029560 3300042612 Bacteria 8203
37 Ga0466705_031879 3300042612 Bacteria 10509
38 Ga0466705_133727 3300042612 Archaea 3874
39 Ga0466705_148078 3300042612 Bacteria 18430
40 Ga0456237_0001124 3300041968 Bacteria 4223
41 Ga0466692_138599 3300042591 Bacteria 8632
42 Ga0466711_098425 3300042615 Bacteria 2485
43 Ga0466711_446407 3300042615 Bacteria 6896
44 Ga0466723_090744 3300042618 Bacteria 8755
45 Ga0466723_097809 3300042618 Bacteria 15903
46 Ga0466716_045521 3300042605 Bacteria 2090
47 Ga0466719_221649 3300042606 Bacteria 8087
48 Ga0466703_040091 3300042636 Bacteria 4539
49 Ga0466703_373741 3300042636 Bacteria 12518
50 Ga0466704_126534 3300042643 Bacteria 3615
51 Ga0466704_143874 3300042643 Bacteria 3920
52 Ga0466704_324299 3300042643 Bacteria 17934
53 Ga0466704_431250 3300042643 Bacteria 6943
54 Ga0466709_102561 3300042648 Bacteria 9229
55 Ga0466708_191601 3300042652 Bacteria 1616
56 Ga0466708_444210 3300042652 Bacteria 5266
57 Ga0466691_068002 3300042593 Bacteria 7543
58 Ga0466696_084284 3300042596 Bacteria 11961
59 Ga0466715_021679 3300042616 Bacteria 2567
60 Ga0466715_030758 3300042616 Bacteria 5405
61 Ga0466715_378213 3300042616 Bacteria 10046
62 Ga0466723_139402 3300042618 Bacteria 2869
63 Ga0466723_281090 3300042618 Bacteria 178430
64 Ga0466728_071679 3300042620 Bacteria 7013
65 Ga0466719_022921 3300042606 Bacteria 12689
66 Ga0466719_068434 3300042606 Bacteria 3566
67 Ga0466719_195435 3300042606 Bacteria 5569
68 Ga0466719_201342 3300042606 Bacteria 38826
69 Ga0466719_267637 3300042606 Bacteria 28659
70 Ga0466719_387797 3300042606 Bacteria 3836
71 Ga0466722_253291 3300042609 Bacteria 4657
72 IMNBL1DRAFT_c0002034 3300000062 Bacteria 14478
73 Ga0466704_507127 3300042643 Bacteria 2514
74 Ga0466708_014472 3300042652 Bacteria 11308
75 Ga0466708_094767 3300042652 Bacteria 1646
76 Ga0466708_253144 3300042652 Bacteria 2728
77 Ga0466705_238115 3300042612 Bacteria 12870
78 Ga0466705_323097 3300042612 Bacteria 23722
79 Ga0466690_147591 3300042590 Bacteria 32255
80 Ga0466692_051292 3300042591 Bacteria 6887
81 Ga0466705_420696 3300042612 Bacteria 26047
82 Ga0466705_476837 3300042612 Bacteria 5230
83 Ga0466705_513492 3300042612 Bacteria 16267
84 Ga0466711_230518 3300042615 Bacteria 7426
85 Ga0466711_515942 3300042615 Bacteria 9558
86 Ga0466715_029876 3300042616 Bacteria 14989
87 Ga0466715_318017 3300042616 Unclassified 3556
88 Ga0466707_119990 3300042601 Bacteria 5810
89 Ga0466716_366847 3300042605 Bacteria 14669
90 Ga0466719_014073 3300042606 Bacteria 12893
91 Ga0466719_300246 3300042606 Bacteria 2661
92 Ga0466719_553817 3300042606 Bacteria 5750
93 Ga0466722_121120 3300042609 Bacteria 14532
94 Ga0466722_225421 3300042609 Bacteria 13615
95 Ga0466703_077630 3300042636 Bacteria 5978
96 Ga0466703_107744 3300042636 Bacteria 6915
97 Ga0466704_416366 3300042643 Bacteria 71162
98 Ga0466708_032881 3300042652 Bacteria 3389
99 Ga0466727_218481 3300042655 Bacteria 19155
100 Ga0466692_142514 3300042591 Bacteria 23774
101 Ga0466691_089028 3300042593 Bacteria 39976
102 Ga0466696_129745 3300042596 Bacteria 25058
103 Ga0466696_391881 3300042596 Bacteria 28341
104 Ga0466696_486898 3300042596 Bacteria 2225
105 Ga0466711_386013 3300042615 Bacteria 43861
106 Ga0466715_006475 3300042616 Bacteria 6878
107 Ga0466715_143194 3300042616 Bacteria 31634
108 Ga0466715_536672 3300042616 Bacteria 31757
109 Ga0466723_352132 3300042618 Bacteria 2069
110 Ga0466726_110114 3300042619 Bacteria 8248
111 Ga0466704_061006 3300042643 Bacteria 8517
112 Ga0466704_457799 3300042643 Bacteria 4308
113 Ga0466709_224651 3300042648 Bacteria 5016
114 Ga0316159_10001 3300030930 Bacteria 1642808
115 Ga0466690_398478 3300042590 Bacteria 5377
116 Ga0466692_068938 3300042591 Bacteria 6210
117 Ga0466691_028132 3300042593 Bacteria 6060
118 Ga0466691_045771 3300042593 Bacteria 3176
119 Ga0466691_169067 3300042593 Bacteria 6807
120 Ga0466705_458999 3300042612 Bacteria 5294
121 Ga0466705_475828 3300042612 Bacteria 24901
122 Ga0466715_012517 3300042616 Bacteria 6695
123 Ga0466723_000780 3300042618 Bacteria 6053
124 Ga0466703_112443 3300042636 Bacteria 10962
125 Ga0466703_223986 3300042636 Bacteria 12300
126 Ga0466704_342537 3300042643 Unclassified 60255
127 Ga0466704_416408 3300042643 Bacteria 9984
128 Ga0466704_476936 3300042643 Bacteria 4830
129 Ga0466704_503977 3300042643 Bacteria 51073
130 Ga0466704_584818 3300042643 Unclassified 6609
131 Ga0466708_096630 3300042652 Bacteria 8366
132 Ga0466708_124431 3300042652 Bacteria 23477
133 Ga0466708_381931 3300042652 Bacteria 28964
134 Ga0466705_034607 3300042612 Bacteria 4429
135 Ga0466705_106556 3300042612 Bacteria 23744
136 Ga0466705_126488 3300042612 Bacteria 5087
137 Ga0466692_171080 3300042591 Bacteria 12578
138 Ga0466691_055628 3300042593 Bacteria 38394
139 Ga0466705_411844 3300042612 Bacteria 13683
140 Ga0466711_135393 3300042615 Bacteria 49716
141 Ga0466711_200213 3300042615 Bacteria 21488
142 Ga0466715_012366 3300042616 Bacteria 6643
143 Ga0466715_070957 3300042616 Bacteria 9997
144 Ga0466723_313490 3300042618 Bacteria 6060
145 Ga0466728_091223 3300042620 Bacteria 8189
146 Ga0466716_060929 3300042605 Bacteria 4059
147 Ga0466716_089866 3300042605 Bacteria 3111
148 Ga0466719_024214 3300042606 Bacteria 6863
149 Ga0466719_308569 3300042606 Bacteria 54924
150 Ga0466703_080413 3300042636 Bacteria 7969
151 Ga0466704_040407 3300042643 Bacteria 30014
152 Ga0466704_197523 3300042643 Bacteria 10330
153 Ga0466709_373148 3300042648 Bacteria 39663

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 388 537 0.98
PF00664 ABC_membrane ABC transporter transmembrane region 48 320 0.86
PF02463 SMC_N RecF/RecN/SMC N terminal domain 398 579 0.77

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.