Protein Family IF09526

Metagenome Metatranscriptome Isolate
234 Members
72 Samples
212 Scaffolds
174.58 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_506267|Ga0466704_506267_7054_7692
Length
212 aa
Sequence
MTEKSKRNHPVPSPRRQEGACSARITLYNRPLLNRGGGGQLSDKDLRINEQIRVREVRLIRDEGEQQGIMSTLEALNIARGVGLDLVEVAPQANPPVVKIMDYGKFKFENEKKVRDSKRKQKLLKLKEIRMQPKIDDHDLDFKSKHVREFLGEGNKVKVTVRFRGRELAHTELGLVVLKDVLARVEGDYVMDKPPAMEGRFMSMVLSPKSKK

πŸ“Š Sample Types

Isolate 9.4%
Metagenome 90.2%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 36.6%
Unclassified 33.8%
Kalotermitidae 19.7%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 199
Eukaryota 0
Viruses 0
Unclassified 35

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
2 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
3 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
4 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
14 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
15 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
27 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
37 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
38 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
43 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
44 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
46 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
47 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
48 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
49 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
50 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
51 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
52 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
57 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
58 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
59 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
60 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
61 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
62 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
63 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
64 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
65 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
66 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
67 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
68 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
69 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
70 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
71 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_008928 3300042656 Unclassified 1116
2 Ga0466732_212815 3300042656 Unclassified 2532
3 Ga0466711_209386 3300042615 Unclassified 2690
4 Ga0466711_433891 3300042615 Bacteria 6384
5 Ga0466715_534972 3300042616 Bacteria 7927
6 Ga0466718_011787 3300042617 Bacteria 3192
7 Ga0466718_121154 3300042617 Unclassified 3089
8 Ga0466726_184181 3300042619 Bacteria 1171
9 Ga0466726_475227 3300042619 Bacteria 1879
10 Ga0466728_144243 3300042620 Bacteria 10187
11 Ga0123356_10260950 3300010049 Bacteria 1816
12 Ga0123356_10366682 3300010049 Bacteria 1569
13 Ga0123356_10657018 3300010049 Bacteria 1216
14 Ga0466716_183130 3300042605 Bacteria 5333
15 Ga0466719_127301 3300042606 Bacteria 9111
16 Ga0466698_160062 3300042610 Bacteria 1384
17 Ga0466735_116096 3300042624 Bacteria 1620
18 Ga0466704_550851 3300042643 Bacteria 33976
19 Ga0466708_013823 3300042652 Bacteria 15268
20 Ga0466708_053711 3300042652 Unclassified 1487
21 Ga0466727_034103 3300042655 Bacteria 7989
22 Ga0415639_007040 3300038395 Bacteria 18589
23 AustNasuHG_c1031013 3300000089 Bacteria 1521
24 JGI24698J34947_10002166 3300002449 Bacteria 10530
25 JGI24698J34947_10025898 3300002449 Bacteria 3119
26 JGI24695J34938_10006745 3300002450 Bacteria 6832
27 JGI24695J34938_10018363 3300002450 Bacteria 3500
28 JGI24695J34938_10035818 3300002450 Bacteria 2267
29 JGI24696J40584_12841894 3300002834 Bacteria 957
30 Ga0466705_187250 3300042612 Bacteria 6494
31 Ga0466732_259616 3300042656 Unclassified 1410
32 Ga0466712_041366 3300042614 Bacteria 20914
33 Ga0466712_075745 3300042614 Bacteria 8656
34 Ga0466712_091946 3300042614 Bacteria 86490
35 Ga0466715_559922 3300042616 Bacteria 5168
36 Ga0466723_001691 3300042618 Bacteria 2082
37 Ga0466723_075852 3300042618 Bacteria 5783
38 Ga0466726_372216 3300042619 Bacteria 1192
39 Ga0466728_125878 3300042620 Bacteria 24281
40 Ga0466729_001096 3300042621 Bacteria 1959
41 Ga0466729_070616 3300042621 Bacteria 1853
42 Ga0123357_10005397 3300009784 Bacteria 15300
43 Ga0123356_10000993 3300010049 Bacteria 31501
44 Ga0123356_10042914 3300010049 Unclassified 4211
45 Ga0466706_161849 3300042599 Bacteria 2268
46 Ga0466716_036090 3300042605 Bacteria 5759
47 Ga0466716_099917 3300042605 Bacteria 5465
48 Ga0466721_012527 3300042608 Bacteria 1615
49 Ga0466722_107842 3300042609 Bacteria 9602
50 Ga0466722_189659 3300042609 Bacteria 4545
51 Ga0466703_188624 3300042636 Bacteria 2641
52 Ga0466704_184197 3300042643 Unclassified 2083
53 Ga0466704_479369 3300042643 Bacteria 8748
54 Ga0466704_538516 3300042643 Bacteria 9487
55 Ga0466708_309686 3300042652 Bacteria 19106
56 Ga0466708_464721 3300042652 Bacteria 4680
57 Ga0466690_098327 3300042590 Bacteria 13880
58 Ga0466690_283801 3300042590 Bacteria 4881
59 Ga0466691_106025 3300042593 Bacteria 17567
60 Ga0466696_259712 3300042596 Bacteria 29051
61 JGI24698J34947_10079004 3300002449 Unclassified 1550
62 JGI24695J34938_10007879 3300002450 Bacteria 6164
63 JGI24695J34938_10014678 3300002450 Bacteria 4049
64 Ga0074263_116024 3300005485 Bacteria 865
65 Ga0466732_289513 3300042656 Unclassified 1656
66 Ga0466715_374931 3300042616 Bacteria 1639
67 Ga0466718_119168 3300042617 Bacteria 12480
68 Ga0466723_267584 3300042618 Bacteria 10696
69 Ga0466728_002480 3300042620 Unclassified 1792
70 Ga0466728_213670 3300042620 Unclassified 2605
71 Ga0123356_10002372 3300010049 Bacteria 20189
72 Ga0123353_10391699 3300010167 Unclassified 2072
73 Ga0466706_042141 3300042599 Bacteria 2970
74 Ga0466703_068447 3300042636 Bacteria 14868
75 Ga0466708_267334 3300042652 Bacteria 7530
76 Ga0466708_269226 3300042652 Bacteria 9783
77 Ga0466727_000110 3300042655 Bacteria 11699
78 Ga0264413_110293 3300024493 Bacteria 13666
79 Ga0466690_420697 3300042590 Bacteria 2388
80 Ga0466692_092840 3300042591 Bacteria 19467
81 Ga0466694_049035 3300042594 Bacteria 10888
82 Ga0466696_290089 3300042596 Bacteria 9192
83 Ga0466699_190731 3300042597 Bacteria 21954
84 Ga0466699_236305 3300042597 Bacteria 5713
85 JGI24695J34938_10026071 3300002450 Unclassified 2782
86 JGI24702J35022_10002824 3300002462 Bacteria 10527
87 JGI24697J35500_11242043 3300002507 Bacteria 2260
88 Ga0466705_314905 3300042612 Bacteria 4418
89 Ga0466712_132840 3300042614 Bacteria 14358
90 Ga0466711_436706 3300042615 Bacteria 1679
91 Ga0466718_059636 3300042617 Bacteria 1030
92 Ga0466718_167350 3300042617 Bacteria 3911
93 Ga0466723_123847 3300042618 Bacteria 7249
94 Ga0123356_10000042 3300010049 Bacteria 135091
95 Ga0123353_10193092 3300010167 Bacteria 3212
96 Ga0466700_322458 3300042600 Unclassified 1310
97 Ga0466707_262100 3300042601 Bacteria 1191
98 Ga0466720_076481 3300042607 Bacteria 15282
99 Ga0466729_208161 3300042621 Bacteria 5876
100 Ga0466703_270850 3300042636 Bacteria 13720
101 Ga0466703_292396 3300042636 Bacteria 5907
102 Ga0466704_245908 3300042643 Bacteria 5553
103 Ga0466709_250824 3300042648 Unclassified 1694
104 Ga0466727_198830 3300042655 Bacteria 1992
105 Ga0466690_215109 3300042590 Bacteria 18021
106 Ga0466692_156128 3300042591 Unclassified 2415
107 Ga0466696_422487 3300042596 Bacteria 18673
108 Ga0466699_053531 3300042597 Unclassified 1845
109 JGI24698J34947_10272830 3300002449 Unclassified 622
110 JGI24695J34938_10000007 3300002450 Bacteria 136740
111 JGI24695J34938_10103320 3300002450 Bacteria 1163
112 Ga0072940_1019000 3300005200 Unclassified 1664
113 Ga0466705_069098 3300042612 Bacteria 10056
114 Ga0466705_106383 3300042612 Bacteria 4113
115 Ga0466712_054741 3300042614 Bacteria 7824
116 Ga0466711_364985 3300042615 Bacteria 14487
117 Ga0466715_045328 3300042616 Bacteria 1463
118 Ga0466715_244540 3300042616 Bacteria 16421
119 Ga0466715_264250 3300042616 Bacteria 16802
120 Ga0466718_038899 3300042617 Bacteria 2239
121 Ga0466728_072758 3300042620 Unclassified 1779
122 Ga0123356_10000482 3300010049 Bacteria 44631
123 Ga0123356_10003085 3300010049 Bacteria 17599
124 Ga0123356_10532333 3300010049 Unclassified 1334
125 Ga0466707_192532 3300042601 Bacteria 5879
126 Ga0466719_128746 3300042606 Bacteria 9047
127 Ga0466719_183327 3300042606 Unclassified 4330
128 Ga0466735_218523 3300042624 Bacteria 1506
129 Ga0466704_108854 3300042643 Bacteria 24907
130 Ga0466708_288804 3300042652 Bacteria 20693
131 Ga0466690_148752 3300042590 Bacteria 3303
132 Ga0466693_261950 3300042592 Bacteria 1478
133 Ga0466691_056949 3300042593 Bacteria 7512
134 Ga0466694_187225 3300042594 Bacteria 6634
135 Ga0466696_327345 3300042596 Bacteria 11315
136 Ga0466699_030076 3300042597 Bacteria 8484
137 AustNasuHG_c1011355 3300000089 Unclassified 3087
138 AustNasuHG_c1020148 3300000089 Bacteria 2177
139 JGI24695J34938_10012927 3300002450 Unclassified 4404
140 JGI24695J34938_10023366 3300002450 Bacteria 2982
141 JGI24705J35276_12225469 3300002504 Bacteria 2725
142 Ga0466705_117364 3300042612 Unclassified 3271
143 Ga0466705_303056 3300042612 Bacteria 8209
144 Ga0466715_599582 3300042616 Bacteria 5912
145 Ga0123356_10048438 3300010049 Bacteria 3955
146 Ga0466706_209209 3300042599 Bacteria 1032
147 Ga0466700_334770 3300042600 Bacteria 1467
148 Ga0466716_151046 3300042605 Bacteria 19901
149 Ga0466719_106294 3300042606 Bacteria 1142
150 Ga0466720_051720 3300042607 Bacteria 1879
151 Ga0466722_079060 3300042609 Bacteria 5508
152 Ga0466735_052698 3300042624 Bacteria 12702
153 Ga0466735_075626 3300042624 Bacteria 11406
154 Ga0466704_590406 3300042643 Bacteria 1107
155 Ga0466709_235409 3300042648 Unclassified 1298
156 Ga0466690_039107 3300042590 Bacteria 3910
157 Ga0466692_167233 3300042591 Bacteria 2679
158 Ga0466694_242144 3300042594 Bacteria 5822
159 Ga0466695_261639 3300042595 Bacteria 1912
160 Ga0466699_142310 3300042597 Unclassified 1290
161 JGI24698J34947_10000003 3300002449 Bacteria 62691
162 JGI24695J34938_10000439 3300002450 Bacteria 40122
163 JGI24695J34938_10022751 3300002450 Bacteria 3035
164 Ga0466705_276857 3300042612 Unclassified 2978
165 Ga0466732_043190 3300042656 Bacteria 9113
166 Ga0466732_181619 3300042656 Unclassified 3374
167 Ga0466712_021690 3300042614 Bacteria 45968
168 Ga0466715_226168 3300042616 Bacteria 12316
169 Ga0466718_093328 3300042617 Bacteria 1168
170 Ga0466723_066740 3300042618 Bacteria 3574
171 Ga0466726_181807 3300042619 Bacteria 1880
172 Ga0123356_10296689 3300010049 Bacteria 1719
173 Ga0466719_419922 3300042606 Bacteria 3840
174 Ga0466731_124246 3300042622 Bacteria 1661
175 Ga0466703_015353 3300042636 Bacteria 3822
176 Ga0466704_506267 3300042643 Bacteria 10877
177 Ga0466709_303144 3300042648 Bacteria 8359
178 Ga0466696_084255 3300042596 Bacteria 3473
179 Ga0466699_020594 3300042597 Unclassified 6074
180 Ga0466699_098414 3300042597 Bacteria 2201
181 AustNasuHG_c1062253 3300000089 Bacteria 715
182 JGI24698J34947_10000327 3300002449 Bacteria 21005
183 JGI24698J34947_10147336 3300002449 Unclassified 983
184 Ga0466732_098682 3300042656 Bacteria 5104
185 Ga0466732_385338 3300042656 Bacteria 1300
186 Ga0466705_518336 3300042612 Bacteria 2821
187 Ga0466715_050532 3300042616 Bacteria 20482
188 Ga0466723_015307 3300042618 Unclassified 1754
189 Ga0466723_061161 3300042618 Bacteria 56205
190 Ga0466723_114548 3300042618 Bacteria 4478
191 Ga0466723_119782 3300042618 Bacteria 1083
192 Ga0466726_019232 3300042619 Bacteria 2542
193 Ga0466728_107104 3300042620 Bacteria 10380
194 Ga0123356_10008251 3300010049 Bacteria 10364
195 Ga0123353_10067889 3300010167 Bacteria 5726
196 Ga0466713_030924 3300042602 Bacteria 1351
197 Ga0466719_121895 3300042606 Bacteria 15848
198 Ga0466719_267909 3300042606 Unclassified 1189
199 Ga0466722_008955 3300042609 Bacteria 11922
200 Ga0466703_106697 3300042636 Bacteria 53394
201 Ga0466704_530517 3300042643 Unclassified 2454
202 Ga0255786_1000885 3300022815 Bacteria 2692
203 Ga0264413_104298 3300024493 Bacteria 5969
204 Ga0466692_136373 3300042591 Bacteria 1002
205 Ga0466691_025546 3300042593 Bacteria 10734
206 Ga0466691_058591 3300042593 Bacteria 11263
207 Ga0466695_343480 3300042595 Bacteria 1308
208 AustNasuHG_c1000112 3300000089 Bacteria 24525
209 JGI24698J34947_10001789 3300002449 Bacteria 11464
210 JGI24698J34947_10011717 3300002449 Bacteria 4815
211 JGI24695J34938_10000791 3300002450 Bacteria 29479
212 JGI24695J34938_10011742 3300002450 Bacteria 4699

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00707 IF3_C Translation initiation factor IF-3, C-terminal domain 125 209 0.99
PF05198 IF3_N Translation initiation factor IF-3, N-terminal domain 48 116 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00707 GO:0006413 translational initiation BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.