Protein Family IF09526
Metagenome
Metatranscriptome
Isolate
234
Members
72
Samples
212
Scaffolds
174.58
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_506267|Ga0466704_506267_7054_7692
- Length
- 212 aa
- Sequence
- MTEKSKRNHPVPSPRRQEGACSARITLYNRPLLNRGGGGQLSDKDLRINEQIRVREVRLIRDEGEQQGIMSTLEALNIARGVGLDLVEVAPQANPPVVKIMDYGKFKFENEKKVRDSKRKQKLLKLKEIRMQPKIDDHDLDFKSKHVREFLGEGNKVKVTVRFRGRELAHTELGLVVLKDVLARVEGDYVMDKPPAMEGRFMSMVLSPKSKK
Sample Types
Isolate
9.4%
Metagenome
90.2%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.6%
Unclassified
33.8%
Kalotermitidae
19.7%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
199
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 2 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 3 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 4 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 14 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 15 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 27 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 37 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 43 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 44 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 47 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 48 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 49 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 50 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 57 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 58 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 66 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 67 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 68 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 69 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 70 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 71 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 72 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_008928 | 3300042656 | Unclassified | 1116 |
| 2 | Ga0466732_212815 | 3300042656 | Unclassified | 2532 |
| 3 | Ga0466711_209386 | 3300042615 | Unclassified | 2690 |
| 4 | Ga0466711_433891 | 3300042615 | Bacteria | 6384 |
| 5 | Ga0466715_534972 | 3300042616 | Bacteria | 7927 |
| 6 | Ga0466718_011787 | 3300042617 | Bacteria | 3192 |
| 7 | Ga0466718_121154 | 3300042617 | Unclassified | 3089 |
| 8 | Ga0466726_184181 | 3300042619 | Bacteria | 1171 |
| 9 | Ga0466726_475227 | 3300042619 | Bacteria | 1879 |
| 10 | Ga0466728_144243 | 3300042620 | Bacteria | 10187 |
| 11 | Ga0123356_10260950 | 3300010049 | Bacteria | 1816 |
| 12 | Ga0123356_10366682 | 3300010049 | Bacteria | 1569 |
| 13 | Ga0123356_10657018 | 3300010049 | Bacteria | 1216 |
| 14 | Ga0466716_183130 | 3300042605 | Bacteria | 5333 |
| 15 | Ga0466719_127301 | 3300042606 | Bacteria | 9111 |
| 16 | Ga0466698_160062 | 3300042610 | Bacteria | 1384 |
| 17 | Ga0466735_116096 | 3300042624 | Bacteria | 1620 |
| 18 | Ga0466704_550851 | 3300042643 | Bacteria | 33976 |
| 19 | Ga0466708_013823 | 3300042652 | Bacteria | 15268 |
| 20 | Ga0466708_053711 | 3300042652 | Unclassified | 1487 |
| 21 | Ga0466727_034103 | 3300042655 | Bacteria | 7989 |
| 22 | Ga0415639_007040 | 3300038395 | Bacteria | 18589 |
| 23 | AustNasuHG_c1031013 | 3300000089 | Bacteria | 1521 |
| 24 | JGI24698J34947_10002166 | 3300002449 | Bacteria | 10530 |
| 25 | JGI24698J34947_10025898 | 3300002449 | Bacteria | 3119 |
| 26 | JGI24695J34938_10006745 | 3300002450 | Bacteria | 6832 |
| 27 | JGI24695J34938_10018363 | 3300002450 | Bacteria | 3500 |
| 28 | JGI24695J34938_10035818 | 3300002450 | Bacteria | 2267 |
| 29 | JGI24696J40584_12841894 | 3300002834 | Bacteria | 957 |
| 30 | Ga0466705_187250 | 3300042612 | Bacteria | 6494 |
| 31 | Ga0466732_259616 | 3300042656 | Unclassified | 1410 |
| 32 | Ga0466712_041366 | 3300042614 | Bacteria | 20914 |
| 33 | Ga0466712_075745 | 3300042614 | Bacteria | 8656 |
| 34 | Ga0466712_091946 | 3300042614 | Bacteria | 86490 |
| 35 | Ga0466715_559922 | 3300042616 | Bacteria | 5168 |
| 36 | Ga0466723_001691 | 3300042618 | Bacteria | 2082 |
| 37 | Ga0466723_075852 | 3300042618 | Bacteria | 5783 |
| 38 | Ga0466726_372216 | 3300042619 | Bacteria | 1192 |
| 39 | Ga0466728_125878 | 3300042620 | Bacteria | 24281 |
| 40 | Ga0466729_001096 | 3300042621 | Bacteria | 1959 |
| 41 | Ga0466729_070616 | 3300042621 | Bacteria | 1853 |
| 42 | Ga0123357_10005397 | 3300009784 | Bacteria | 15300 |
| 43 | Ga0123356_10000993 | 3300010049 | Bacteria | 31501 |
| 44 | Ga0123356_10042914 | 3300010049 | Unclassified | 4211 |
| 45 | Ga0466706_161849 | 3300042599 | Bacteria | 2268 |
| 46 | Ga0466716_036090 | 3300042605 | Bacteria | 5759 |
| 47 | Ga0466716_099917 | 3300042605 | Bacteria | 5465 |
| 48 | Ga0466721_012527 | 3300042608 | Bacteria | 1615 |
| 49 | Ga0466722_107842 | 3300042609 | Bacteria | 9602 |
| 50 | Ga0466722_189659 | 3300042609 | Bacteria | 4545 |
| 51 | Ga0466703_188624 | 3300042636 | Bacteria | 2641 |
| 52 | Ga0466704_184197 | 3300042643 | Unclassified | 2083 |
| 53 | Ga0466704_479369 | 3300042643 | Bacteria | 8748 |
| 54 | Ga0466704_538516 | 3300042643 | Bacteria | 9487 |
| 55 | Ga0466708_309686 | 3300042652 | Bacteria | 19106 |
| 56 | Ga0466708_464721 | 3300042652 | Bacteria | 4680 |
| 57 | Ga0466690_098327 | 3300042590 | Bacteria | 13880 |
| 58 | Ga0466690_283801 | 3300042590 | Bacteria | 4881 |
| 59 | Ga0466691_106025 | 3300042593 | Bacteria | 17567 |
| 60 | Ga0466696_259712 | 3300042596 | Bacteria | 29051 |
| 61 | JGI24698J34947_10079004 | 3300002449 | Unclassified | 1550 |
| 62 | JGI24695J34938_10007879 | 3300002450 | Bacteria | 6164 |
| 63 | JGI24695J34938_10014678 | 3300002450 | Bacteria | 4049 |
| 64 | Ga0074263_116024 | 3300005485 | Bacteria | 865 |
| 65 | Ga0466732_289513 | 3300042656 | Unclassified | 1656 |
| 66 | Ga0466715_374931 | 3300042616 | Bacteria | 1639 |
| 67 | Ga0466718_119168 | 3300042617 | Bacteria | 12480 |
| 68 | Ga0466723_267584 | 3300042618 | Bacteria | 10696 |
| 69 | Ga0466728_002480 | 3300042620 | Unclassified | 1792 |
| 70 | Ga0466728_213670 | 3300042620 | Unclassified | 2605 |
| 71 | Ga0123356_10002372 | 3300010049 | Bacteria | 20189 |
| 72 | Ga0123353_10391699 | 3300010167 | Unclassified | 2072 |
| 73 | Ga0466706_042141 | 3300042599 | Bacteria | 2970 |
| 74 | Ga0466703_068447 | 3300042636 | Bacteria | 14868 |
| 75 | Ga0466708_267334 | 3300042652 | Bacteria | 7530 |
| 76 | Ga0466708_269226 | 3300042652 | Bacteria | 9783 |
| 77 | Ga0466727_000110 | 3300042655 | Bacteria | 11699 |
| 78 | Ga0264413_110293 | 3300024493 | Bacteria | 13666 |
| 79 | Ga0466690_420697 | 3300042590 | Bacteria | 2388 |
| 80 | Ga0466692_092840 | 3300042591 | Bacteria | 19467 |
| 81 | Ga0466694_049035 | 3300042594 | Bacteria | 10888 |
| 82 | Ga0466696_290089 | 3300042596 | Bacteria | 9192 |
| 83 | Ga0466699_190731 | 3300042597 | Bacteria | 21954 |
| 84 | Ga0466699_236305 | 3300042597 | Bacteria | 5713 |
| 85 | JGI24695J34938_10026071 | 3300002450 | Unclassified | 2782 |
| 86 | JGI24702J35022_10002824 | 3300002462 | Bacteria | 10527 |
| 87 | JGI24697J35500_11242043 | 3300002507 | Bacteria | 2260 |
| 88 | Ga0466705_314905 | 3300042612 | Bacteria | 4418 |
| 89 | Ga0466712_132840 | 3300042614 | Bacteria | 14358 |
| 90 | Ga0466711_436706 | 3300042615 | Bacteria | 1679 |
| 91 | Ga0466718_059636 | 3300042617 | Bacteria | 1030 |
| 92 | Ga0466718_167350 | 3300042617 | Bacteria | 3911 |
| 93 | Ga0466723_123847 | 3300042618 | Bacteria | 7249 |
| 94 | Ga0123356_10000042 | 3300010049 | Bacteria | 135091 |
| 95 | Ga0123353_10193092 | 3300010167 | Bacteria | 3212 |
| 96 | Ga0466700_322458 | 3300042600 | Unclassified | 1310 |
| 97 | Ga0466707_262100 | 3300042601 | Bacteria | 1191 |
| 98 | Ga0466720_076481 | 3300042607 | Bacteria | 15282 |
| 99 | Ga0466729_208161 | 3300042621 | Bacteria | 5876 |
| 100 | Ga0466703_270850 | 3300042636 | Bacteria | 13720 |
| 101 | Ga0466703_292396 | 3300042636 | Bacteria | 5907 |
| 102 | Ga0466704_245908 | 3300042643 | Bacteria | 5553 |
| 103 | Ga0466709_250824 | 3300042648 | Unclassified | 1694 |
| 104 | Ga0466727_198830 | 3300042655 | Bacteria | 1992 |
| 105 | Ga0466690_215109 | 3300042590 | Bacteria | 18021 |
| 106 | Ga0466692_156128 | 3300042591 | Unclassified | 2415 |
| 107 | Ga0466696_422487 | 3300042596 | Bacteria | 18673 |
| 108 | Ga0466699_053531 | 3300042597 | Unclassified | 1845 |
| 109 | JGI24698J34947_10272830 | 3300002449 | Unclassified | 622 |
| 110 | JGI24695J34938_10000007 | 3300002450 | Bacteria | 136740 |
| 111 | JGI24695J34938_10103320 | 3300002450 | Bacteria | 1163 |
| 112 | Ga0072940_1019000 | 3300005200 | Unclassified | 1664 |
| 113 | Ga0466705_069098 | 3300042612 | Bacteria | 10056 |
| 114 | Ga0466705_106383 | 3300042612 | Bacteria | 4113 |
| 115 | Ga0466712_054741 | 3300042614 | Bacteria | 7824 |
| 116 | Ga0466711_364985 | 3300042615 | Bacteria | 14487 |
| 117 | Ga0466715_045328 | 3300042616 | Bacteria | 1463 |
| 118 | Ga0466715_244540 | 3300042616 | Bacteria | 16421 |
| 119 | Ga0466715_264250 | 3300042616 | Bacteria | 16802 |
| 120 | Ga0466718_038899 | 3300042617 | Bacteria | 2239 |
| 121 | Ga0466728_072758 | 3300042620 | Unclassified | 1779 |
| 122 | Ga0123356_10000482 | 3300010049 | Bacteria | 44631 |
| 123 | Ga0123356_10003085 | 3300010049 | Bacteria | 17599 |
| 124 | Ga0123356_10532333 | 3300010049 | Unclassified | 1334 |
| 125 | Ga0466707_192532 | 3300042601 | Bacteria | 5879 |
| 126 | Ga0466719_128746 | 3300042606 | Bacteria | 9047 |
| 127 | Ga0466719_183327 | 3300042606 | Unclassified | 4330 |
| 128 | Ga0466735_218523 | 3300042624 | Bacteria | 1506 |
| 129 | Ga0466704_108854 | 3300042643 | Bacteria | 24907 |
| 130 | Ga0466708_288804 | 3300042652 | Bacteria | 20693 |
| 131 | Ga0466690_148752 | 3300042590 | Bacteria | 3303 |
| 132 | Ga0466693_261950 | 3300042592 | Bacteria | 1478 |
| 133 | Ga0466691_056949 | 3300042593 | Bacteria | 7512 |
| 134 | Ga0466694_187225 | 3300042594 | Bacteria | 6634 |
| 135 | Ga0466696_327345 | 3300042596 | Bacteria | 11315 |
| 136 | Ga0466699_030076 | 3300042597 | Bacteria | 8484 |
| 137 | AustNasuHG_c1011355 | 3300000089 | Unclassified | 3087 |
| 138 | AustNasuHG_c1020148 | 3300000089 | Bacteria | 2177 |
| 139 | JGI24695J34938_10012927 | 3300002450 | Unclassified | 4404 |
| 140 | JGI24695J34938_10023366 | 3300002450 | Bacteria | 2982 |
| 141 | JGI24705J35276_12225469 | 3300002504 | Bacteria | 2725 |
| 142 | Ga0466705_117364 | 3300042612 | Unclassified | 3271 |
| 143 | Ga0466705_303056 | 3300042612 | Bacteria | 8209 |
| 144 | Ga0466715_599582 | 3300042616 | Bacteria | 5912 |
| 145 | Ga0123356_10048438 | 3300010049 | Bacteria | 3955 |
| 146 | Ga0466706_209209 | 3300042599 | Bacteria | 1032 |
| 147 | Ga0466700_334770 | 3300042600 | Bacteria | 1467 |
| 148 | Ga0466716_151046 | 3300042605 | Bacteria | 19901 |
| 149 | Ga0466719_106294 | 3300042606 | Bacteria | 1142 |
| 150 | Ga0466720_051720 | 3300042607 | Bacteria | 1879 |
| 151 | Ga0466722_079060 | 3300042609 | Bacteria | 5508 |
| 152 | Ga0466735_052698 | 3300042624 | Bacteria | 12702 |
| 153 | Ga0466735_075626 | 3300042624 | Bacteria | 11406 |
| 154 | Ga0466704_590406 | 3300042643 | Bacteria | 1107 |
| 155 | Ga0466709_235409 | 3300042648 | Unclassified | 1298 |
| 156 | Ga0466690_039107 | 3300042590 | Bacteria | 3910 |
| 157 | Ga0466692_167233 | 3300042591 | Bacteria | 2679 |
| 158 | Ga0466694_242144 | 3300042594 | Bacteria | 5822 |
| 159 | Ga0466695_261639 | 3300042595 | Bacteria | 1912 |
| 160 | Ga0466699_142310 | 3300042597 | Unclassified | 1290 |
| 161 | JGI24698J34947_10000003 | 3300002449 | Bacteria | 62691 |
| 162 | JGI24695J34938_10000439 | 3300002450 | Bacteria | 40122 |
| 163 | JGI24695J34938_10022751 | 3300002450 | Bacteria | 3035 |
| 164 | Ga0466705_276857 | 3300042612 | Unclassified | 2978 |
| 165 | Ga0466732_043190 | 3300042656 | Bacteria | 9113 |
| 166 | Ga0466732_181619 | 3300042656 | Unclassified | 3374 |
| 167 | Ga0466712_021690 | 3300042614 | Bacteria | 45968 |
| 168 | Ga0466715_226168 | 3300042616 | Bacteria | 12316 |
| 169 | Ga0466718_093328 | 3300042617 | Bacteria | 1168 |
| 170 | Ga0466723_066740 | 3300042618 | Bacteria | 3574 |
| 171 | Ga0466726_181807 | 3300042619 | Bacteria | 1880 |
| 172 | Ga0123356_10296689 | 3300010049 | Bacteria | 1719 |
| 173 | Ga0466719_419922 | 3300042606 | Bacteria | 3840 |
| 174 | Ga0466731_124246 | 3300042622 | Bacteria | 1661 |
| 175 | Ga0466703_015353 | 3300042636 | Bacteria | 3822 |
| 176 | Ga0466704_506267 | 3300042643 | Bacteria | 10877 |
| 177 | Ga0466709_303144 | 3300042648 | Bacteria | 8359 |
| 178 | Ga0466696_084255 | 3300042596 | Bacteria | 3473 |
| 179 | Ga0466699_020594 | 3300042597 | Unclassified | 6074 |
| 180 | Ga0466699_098414 | 3300042597 | Bacteria | 2201 |
| 181 | AustNasuHG_c1062253 | 3300000089 | Bacteria | 715 |
| 182 | JGI24698J34947_10000327 | 3300002449 | Bacteria | 21005 |
| 183 | JGI24698J34947_10147336 | 3300002449 | Unclassified | 983 |
| 184 | Ga0466732_098682 | 3300042656 | Bacteria | 5104 |
| 185 | Ga0466732_385338 | 3300042656 | Bacteria | 1300 |
| 186 | Ga0466705_518336 | 3300042612 | Bacteria | 2821 |
| 187 | Ga0466715_050532 | 3300042616 | Bacteria | 20482 |
| 188 | Ga0466723_015307 | 3300042618 | Unclassified | 1754 |
| 189 | Ga0466723_061161 | 3300042618 | Bacteria | 56205 |
| 190 | Ga0466723_114548 | 3300042618 | Bacteria | 4478 |
| 191 | Ga0466723_119782 | 3300042618 | Bacteria | 1083 |
| 192 | Ga0466726_019232 | 3300042619 | Bacteria | 2542 |
| 193 | Ga0466728_107104 | 3300042620 | Bacteria | 10380 |
| 194 | Ga0123356_10008251 | 3300010049 | Bacteria | 10364 |
| 195 | Ga0123353_10067889 | 3300010167 | Bacteria | 5726 |
| 196 | Ga0466713_030924 | 3300042602 | Bacteria | 1351 |
| 197 | Ga0466719_121895 | 3300042606 | Bacteria | 15848 |
| 198 | Ga0466719_267909 | 3300042606 | Unclassified | 1189 |
| 199 | Ga0466722_008955 | 3300042609 | Bacteria | 11922 |
| 200 | Ga0466703_106697 | 3300042636 | Bacteria | 53394 |
| 201 | Ga0466704_530517 | 3300042643 | Unclassified | 2454 |
| 202 | Ga0255786_1000885 | 3300022815 | Bacteria | 2692 |
| 203 | Ga0264413_104298 | 3300024493 | Bacteria | 5969 |
| 204 | Ga0466692_136373 | 3300042591 | Bacteria | 1002 |
| 205 | Ga0466691_025546 | 3300042593 | Bacteria | 10734 |
| 206 | Ga0466691_058591 | 3300042593 | Bacteria | 11263 |
| 207 | Ga0466695_343480 | 3300042595 | Bacteria | 1308 |
| 208 | AustNasuHG_c1000112 | 3300000089 | Bacteria | 24525 |
| 209 | JGI24698J34947_10001789 | 3300002449 | Bacteria | 11464 |
| 210 | JGI24698J34947_10011717 | 3300002449 | Bacteria | 4815 |
| 211 | JGI24695J34938_10000791 | 3300002450 | Bacteria | 29479 |
| 212 | JGI24695J34938_10011742 | 3300002450 | Bacteria | 4699 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00707 | GO:0006413 | translational initiation | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.