Protein Family IF09518
Metagenome
Isolate
151
Members
54
Samples
142
Scaffolds
246.3
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_475467|Ga0466704_475467_427_1194
- Length
- 255 aa
- Sequence
- MQHYGLIGYPLKHSFSKDYFNDKFEAERIDAQYLNFEIPSIRDFKTILSEHPHLEGLNVTIPYKEQVIPFLDRLSENAQLIGAVNVIKIERNKGKIKRLTGFNSDIIGFKQSIEPLLQPHHRKALVLGTGGAAKAIYYGLSQLGIEPTYVAREKQSDTVLTYSELNAQDMAAQTVIVNCTPVGMWPHVDECPKIPYECLTEQHLLYDLLYNPNETLFMKYGAEQGATVKNGLEMLLLQAFASWEFWRNGTTEAAK
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
25.9%
Unclassified
14.8%
Rhinotermitidae
7.4%
Termopsidae
5.6%
Hydrophilidae
3.7%
Passalidae
3.7%
Blattidae
1.9%
Hodotermitidae
1.9%
Tenebrionidae
1.9%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 12 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 18 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 19 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 20 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 34 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 52 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 54 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_213899 | 3300042659 | Bacteria | 6656 |
| 2 | Ga0466692_084653 | 3300042591 | Bacteria | 16158 |
| 3 | Ga0466694_346395 | 3300042594 | Bacteria | 4069 |
| 4 | Ga0466729_280059 | 3300042621 | Bacteria | 1183 |
| 5 | Ga0466735_038239 | 3300042624 | Bacteria | 1113 |
| 6 | Ga0466735_179575 | 3300042624 | Bacteria | 1455 |
| 7 | Ga0466730_094010 | 3300042625 | Bacteria | 2264 |
| 8 | Ga0466708_006861 | 3300042652 | Bacteria | 10307 |
| 9 | Ga0123354_10001155 | 3300010882 | Bacteria | 30901 |
| 10 | Ga0123354_10209160 | 3300010882 | Bacteria | 2115 |
| 11 | Ga0466707_045632 | 3300042601 | Bacteria | 15295 |
| 12 | Ga0466713_008813 | 3300042602 | Bacteria | 15834 |
| 13 | Ga0466722_248161 | 3300042609 | Bacteria | 13887 |
| 14 | JGI24699J35502_11134110 | 3300002509 | Bacteria | 31696 |
| 15 | Ga0123357_10000872 | 3300009784 | Bacteria | 30777 |
| 16 | Ga0466711_350857 | 3300042615 | Bacteria | 51542 |
| 17 | Ga0466697_102833 | 3300042611 | Bacteria | 2030 |
| 18 | Ga0466656_182629 | 3300042550 | Bacteria | 2679 |
| 19 | Ga0466691_005837 | 3300042593 | Bacteria | 2664 |
| 20 | Ga0466696_243101 | 3300042596 | Bacteria | 6507 |
| 21 | Ga0466735_116596 | 3300042624 | Bacteria | 6529 |
| 22 | Ga0466703_305044 | 3300042636 | Bacteria | 6580 |
| 23 | Ga0466725_101792 | 3300042654 | Bacteria | 2834 |
| 24 | Ga0466727_033460 | 3300042655 | Bacteria | 3360 |
| 25 | Ga0123357_10064022 | 3300009784 | Bacteria | 4916 |
| 26 | Ga0123356_10822056 | 3300010049 | Bacteria | 1100 |
| 27 | Ga0123354_10006587 | 3300010882 | Bacteria | 17289 |
| 28 | Ga0466713_104624 | 3300042602 | Bacteria | 5452 |
| 29 | Ga0466713_123723 | 3300042602 | Bacteria | 198668 |
| 30 | 2227482436 | 2225789004 | Bacteria | 4379 |
| 31 | IMNBL1DRAFT_c0007321 | 3300000062 | Bacteria | 5834 |
| 32 | JGI24702J35022_10042374 | 3300002462 | Bacteria | 2424 |
| 33 | Ga0466723_269975 | 3300042618 | Bacteria | 19626 |
| 34 | Ga0466726_144572 | 3300042619 | Bacteria | 3072 |
| 35 | Ga0466692_083632 | 3300042591 | Bacteria | 30510 |
| 36 | Ga0466691_151994 | 3300042593 | Bacteria | 12011 |
| 37 | Ga0466735_023932 | 3300042624 | Bacteria | 1951 |
| 38 | Ga0466735_066837 | 3300042624 | Bacteria | 5459 |
| 39 | Ga0466735_120540 | 3300042624 | Bacteria | 1681 |
| 40 | Ga0466703_148257 | 3300042636 | Bacteria | 24506 |
| 41 | Ga0466704_569440 | 3300042643 | Bacteria | 2271 |
| 42 | Ga0466709_039419 | 3300042648 | Bacteria | 67557 |
| 43 | Ga0466727_305974 | 3300042655 | Bacteria | 9046 |
| 44 | Ga0123357_10116171 | 3300009784 | Bacteria | 3389 |
| 45 | Ga0123356_10475452 | 3300010049 | Bacteria | 1402 |
| 46 | Ga0466707_017877 | 3300042601 | Bacteria | 16904 |
| 47 | Ga0466716_395133 | 3300042605 | Bacteria | 6728 |
| 48 | Ga0466719_040113 | 3300042606 | Bacteria | 1912 |
| 49 | IMNBL1DRAFT_c0004767 | 3300000062 | Bacteria | 8011 |
| 50 | Ga0466705_522137 | 3300042612 | Bacteria | 3314 |
| 51 | Ga0466715_137211 | 3300042616 | Bacteria | 4758 |
| 52 | Ga0466723_274504 | 3300042618 | Bacteria | 2147 |
| 53 | Ga0466729_045459 | 3300042621 | Bacteria | 7957 |
| 54 | Ga0466732_071103 | 3300042656 | Bacteria | 1765 |
| 55 | Ga0466690_213523 | 3300042590 | Bacteria | 18139 |
| 56 | Ga0466703_287233 | 3300042636 | Bacteria | 1510 |
| 57 | Ga0466703_377998 | 3300042636 | Bacteria | 2417 |
| 58 | Ga0123357_10004638 | 3300009784 | Bacteria | 16215 |
| 59 | Ga0123353_10535149 | 3300010167 | Bacteria | 1695 |
| 60 | Ga0466700_255519 | 3300042600 | Bacteria | 3249 |
| 61 | Ga0466700_435179 | 3300042600 | Bacteria | 4390 |
| 62 | IMNBL1DRAFT_c0004204 | 3300000062 | Bacteria | 8749 |
| 63 | JGI24699J35502_11133947 | 3300002509 | Bacteria | 20626 |
| 64 | Ga0068305_10111646 | 3300005083 | Bacteria | 2645 |
| 65 | Ga0466726_251828 | 3300042619 | Bacteria | 2987 |
| 66 | Ga0466726_379854 | 3300042619 | Bacteria | 1247 |
| 67 | Ga0466728_111999 | 3300042620 | Bacteria | 4087 |
| 68 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 69 | Ga0466690_169422 | 3300042590 | Bacteria | 39612 |
| 70 | Ga0466691_203048 | 3300042593 | Bacteria | 4850 |
| 71 | Ga0466735_139595 | 3300042624 | Bacteria | 8713 |
| 72 | Ga0466727_078492 | 3300042655 | Bacteria | 66886 |
| 73 | Ga0123357_10064926 | 3300009784 | Bacteria | 4875 |
| 74 | Ga0123356_10652320 | 3300010049 | Bacteria | 1220 |
| 75 | Ga0123354_10156686 | 3300010882 | Bacteria | 2728 |
| 76 | Ga0466706_276180 | 3300042599 | Bacteria | 65753 |
| 77 | Ga0466707_117040 | 3300042601 | Bacteria | 22070 |
| 78 | Ga0466713_000079 | 3300042602 | Bacteria | 9723 |
| 79 | Ga0466713_044686 | 3300042602 | Bacteria | 17655 |
| 80 | Ga0466713_099518 | 3300042602 | Bacteria | 11417 |
| 81 | Ga0466719_184892 | 3300042606 | Bacteria | 10895 |
| 82 | Ga0466722_123031 | 3300042609 | Bacteria | 32122 |
| 83 | Ga0466698_330165 | 3300042610 | Bacteria | 1829 |
| 84 | 2227489109 | 2225789004 | Unclassified | 4142 |
| 85 | Ga0068305_10254952 | 3300005083 | Bacteria | 3640 |
| 86 | Ga0123357_10002530 | 3300009784 | Bacteria | 20462 |
| 87 | Ga0466705_522015 | 3300042612 | Bacteria | 1291 |
| 88 | Ga0466711_329548 | 3300042615 | Bacteria | 10051 |
| 89 | Ga0466735_007579 | 3300042624 | Bacteria | 4984 |
| 90 | Ga0466735_117409 | 3300042624 | Bacteria | 7366 |
| 91 | Ga0466735_119363 | 3300042624 | Bacteria | 1392 |
| 92 | Ga0123357_10635048 | 3300009784 | Bacteria | 799 |
| 93 | Ga0123356_10006425 | 3300010049 | Bacteria | 11847 |
| 94 | Ga0466701_069835 | 3300042598 | Bacteria | 26434 |
| 95 | Ga0466700_265932 | 3300042600 | Bacteria | 1687 |
| 96 | Ga0466707_057971 | 3300042601 | Bacteria | 5446 |
| 97 | Ga0466707_120405 | 3300042601 | Bacteria | 3472 |
| 98 | IMNBL1DRAFT_c0003050 | 3300000062 | Bacteria | 11056 |
| 99 | IMNBL1DRAFT_c0008300 | 3300000062 | Bacteria | 5304 |
| 100 | JGI24702J35022_10000956 | 3300002462 | Bacteria | 18036 |
| 101 | JGI24702J35022_10050265 | 3300002462 | Bacteria | 2220 |
| 102 | Ga0466711_120514 | 3300042615 | Bacteria | 6869 |
| 103 | Ga0466715_376224 | 3300042616 | Bacteria | 43713 |
| 104 | Ga0466705_232740 | 3300042612 | Bacteria | 7883 |
| 105 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 106 | Ga0466692_183742 | 3300042591 | Bacteria | 15201 |
| 107 | Ga0466701_009575 | 3300042598 | Bacteria | 7532 |
| 108 | Ga0466734_112146 | 3300042623 | Bacteria | 1027 |
| 109 | Ga0466735_048431 | 3300042624 | Bacteria | 1783 |
| 110 | Ga0466704_387159 | 3300042643 | Bacteria | 11253 |
| 111 | Ga0466704_456616 | 3300042643 | Bacteria | 35507 |
| 112 | Ga0466727_205527 | 3300042655 | Bacteria | 11545 |
| 113 | Ga0123356_11353666 | 3300010049 | Bacteria | 874 |
| 114 | Ga0123354_10080670 | 3300010882 | Bacteria | 4603 |
| 115 | Ga0123354_10332128 | 3300010882 | Bacteria | 1384 |
| 116 | Ga0466713_037010 | 3300042602 | Bacteria | 2734 |
| 117 | Ga0466716_033455 | 3300042605 | Bacteria | 5469 |
| 118 | Ga0466716_155217 | 3300042605 | Bacteria | 1604 |
| 119 | Ga0466719_422169 | 3300042606 | Bacteria | 6241 |
| 120 | Ga0466723_367514 | 3300042618 | Bacteria | 1631 |
| 121 | Ga0466726_029778 | 3300042619 | Bacteria | 38816 |
| 122 | Ga0466697_225383 | 3300042611 | Bacteria | 1453 |
| 123 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 124 | Ga0466690_133036 | 3300042590 | Bacteria | 7695 |
| 125 | Ga0466692_021898 | 3300042591 | Bacteria | 3903 |
| 126 | Ga0466735_195877 | 3300042624 | Bacteria | 2225 |
| 127 | Ga0466703_062082 | 3300042636 | Bacteria | 16507 |
| 128 | Ga0466703_227876 | 3300042636 | Bacteria | 3299 |
| 129 | Ga0466703_364345 | 3300042636 | Bacteria | 3780 |
| 130 | Ga0466704_475467 | 3300042643 | Bacteria | 2521 |
| 131 | Ga0466709_397134 | 3300042648 | Bacteria | 10448 |
| 132 | Ga0123353_10665689 | 3300010167 | Bacteria | 1470 |
| 133 | Ga0466700_093193 | 3300042600 | Bacteria | 4167 |
| 134 | Ga0466700_369835 | 3300042600 | Bacteria | 46737 |
| 135 | Ga0466707_009633 | 3300042601 | Bacteria | 35190 |
| 136 | Ga0466713_050394 | 3300042602 | Bacteria | 6134 |
| 137 | Ga0466713_118181 | 3300042602 | Bacteria | 33659 |
| 138 | JGI24699J35502_10986423 | 3300002509 | Bacteria | 1292 |
| 139 | JGI24699J35502_11134146 | 3300002509 | Bacteria | 37464 |
| 140 | Ga0068305_10176128 | 3300005083 | Bacteria | 2187 |
| 141 | Ga0072940_1484835 | 3300005200 | Bacteria | 1277 |
| 142 | Ga0466715_367302 | 3300042616 | Bacteria | 9027 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08501 | Shikimate_dh_N | Shikimate dehydrogenase substrate binding domain | 6 | 87 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08501 | GO:0004764 | shikimate 3-dehydrogenase (NADP+) activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.