Protein Family IF09504
Metagenome
Isolate
178
Members
70
Samples
146
Scaffolds
106.31
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_417078|Ga0466704_417078_789_1106
- Length
- 105 aa
- Sequence
- MKKSLLEAASVIRSKNSGPFELTLDIIFKDAQAYRKICEEQQITPQMAADLYHVPLSEILNFVWYAPANSLKITLKRPIDSGSIGERDTYGAQQYAPLLALTVDI
Sample Types
Isolate
18.0%
Metagenome
82.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.1%
Termitidae
22.9%
Blattidae
18.6%
Kalotermitidae
18.6%
Termopsidae
4.3%
Rhinotermitidae
4.3%
Passalidae
2.9%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
163
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 2 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 3 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 4 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 5 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 6 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 7 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 8 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 9 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 10 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 11 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 12 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 17 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 18 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 19 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 20 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 21 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 26 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 27 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 30 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 41 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 42 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 43 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 44 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 45 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 46 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 51 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 59 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 60 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 61 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 62 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 65 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 68 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 69 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 70 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_391740 | 3300042616 | Bacteria | 7851 |
| 2 | Ga0466735_013196 | 3300042624 | Bacteria | 1557 |
| 3 | Ga0466703_124909 | 3300042636 | Unclassified | 2632 |
| 4 | Ga0466704_344304 | 3300042643 | Bacteria | 5917 |
| 5 | Ga0466714_147744 | 3300042603 | Bacteria | 2168 |
| 6 | Ga0123355_10000293 | 3300009826 | Bacteria | 64130 |
| 7 | Ga0123355_10001005 | 3300009826 | Bacteria | 39113 |
| 8 | Ga0123355_10005031 | 3300009826 | Bacteria | 19257 |
| 9 | Ga0123355_10089759 | 3300009826 | Bacteria | 4877 |
| 10 | Ga0123355_10744698 | 3300009826 | Bacteria | 1110 |
| 11 | Ga0123355_10866989 | 3300009826 | Bacteria | 989 |
| 12 | Ga0123355_10877815 | 3300009826 | Bacteria | 980 |
| 13 | Ga0123356_10076237 | 3300010049 | Bacteria | 3160 |
| 14 | Ga0123356_10505631 | 3300010049 | Unclassified | 1365 |
| 15 | Ga0123356_11166873 | 3300010049 | Bacteria | 937 |
| 16 | Ga0123356_12946061 | 3300010049 | Bacteria | 595 |
| 17 | Ga0123353_10266766 | 3300010167 | Bacteria | 2640 |
| 18 | Ga0123353_12368975 | 3300010167 | Bacteria | 636 |
| 19 | Ga0466706_011673 | 3300042599 | Bacteria | 3417 |
| 20 | Ga0123355_10167020 | 3300009826 | Bacteria | 3299 |
| 21 | Ga0123355_10634639 | 3300009826 | Bacteria | 1253 |
| 22 | Ga0123353_10021459 | 3300010167 | Bacteria | 9696 |
| 23 | Ga0123353_10681660 | 3300010167 | Bacteria | 1447 |
| 24 | Ga0123353_10981199 | 3300010167 | Bacteria | 1138 |
| 25 | Ga0123353_11017639 | 3300010167 | Bacteria | 1111 |
| 26 | Ga0123353_11516405 | 3300010167 | Bacteria | 853 |
| 27 | 2227064010 | 2225789003 | Unclassified | 737 |
| 28 | IMNBL1DRAFT_c0003545 | 3300000062 | Bacteria | 9941 |
| 29 | JGI24695J34938_10006950 | 3300002450 | Bacteria | 6716 |
| 30 | Ga0466701_014980 | 3300042598 | Bacteria | 1168 |
| 31 | Ga0466697_125128 | 3300042611 | Bacteria | 2669 |
| 32 | Ga0466705_032059 | 3300042612 | Bacteria | 4813 |
| 33 | Ga0466715_427132 | 3300042616 | Bacteria | 12964 |
| 34 | Ga0466723_036698 | 3300042618 | Bacteria | 5860 |
| 35 | Ga0466734_021280 | 3300042623 | Bacteria | 1563 |
| 36 | Ga0466704_417078 | 3300042643 | Bacteria | 1121 |
| 37 | Ga0466719_158980 | 3300042606 | Bacteria | 6638 |
| 38 | Ga0466721_379530 | 3300042608 | Bacteria | 1621 |
| 39 | Ga0466722_027454 | 3300042609 | Bacteria | 32114 |
| 40 | Ga0123355_10000251 | 3300009826 | Bacteria | 69105 |
| 41 | Ga0123355_10002047 | 3300009826 | Unclassified | 28468 |
| 42 | Ga0123355_10045150 | 3300009826 | Bacteria | 7167 |
| 43 | Ga0123355_10450955 | 3300009826 | Unclassified | 1621 |
| 44 | Ga0123353_10235063 | 3300010167 | Bacteria | 2853 |
| 45 | Ga0123353_10544129 | 3300010167 | Bacteria | 1677 |
| 46 | JGI24702J35022_10060504 | 3300002462 | Bacteria | 2025 |
| 47 | Ga0466728_014869 | 3300042620 | Unclassified | 2188 |
| 48 | Ga0466734_130063 | 3300042623 | Bacteria | 2925 |
| 49 | Ga0466703_020388 | 3300042636 | Bacteria | 11755 |
| 50 | Ga0123357_10125102 | 3300009784 | Bacteria | 3224 |
| 51 | Ga0123355_10003805 | 3300009826 | Bacteria | 21817 |
| 52 | Ga0123355_10028128 | 3300009826 | Bacteria | 9089 |
| 53 | Ga0123355_10098567 | 3300009826 | Bacteria | 4609 |
| 54 | Ga0123355_10847115 | 3300009826 | Bacteria | 1007 |
| 55 | Ga0123355_11602391 | 3300009826 | Bacteria | 627 |
| 56 | Ga0123355_11717849 | 3300009826 | Unclassified | 597 |
| 57 | Ga0123356_10003496 | 3300010049 | Bacteria | 16437 |
| 58 | Ga0123356_10066597 | 3300010049 | Bacteria | 3372 |
| 59 | Ga0123356_10123540 | 3300010049 | Bacteria | 2523 |
| 60 | Ga0123353_10539895 | 3300010167 | Bacteria | 1685 |
| 61 | Ga0123353_10926262 | 3300010167 | Bacteria | 1182 |
| 62 | Ga0123354_10652237 | 3300010882 | Bacteria | 751 |
| 63 | Ga0466690_056298 | 3300042590 | Bacteria | 5408 |
| 64 | Ga0466693_312450 | 3300042592 | Bacteria | 1471 |
| 65 | Ga0466696_184298 | 3300042596 | Bacteria | 6328 |
| 66 | Ga0466710_082239 | 3300042613 | Bacteria | 2258 |
| 67 | Ga0466729_039879 | 3300042621 | Bacteria | 1163 |
| 68 | Ga0466729_170230 | 3300042621 | Bacteria | 1758 |
| 69 | Ga0466703_066174 | 3300042636 | Bacteria | 1325 |
| 70 | Ga0466708_150635 | 3300042652 | Bacteria | 6168 |
| 71 | Ga0123355_10118619 | 3300009826 | Bacteria | 4111 |
| 72 | Ga0123355_10252912 | 3300009826 | Bacteria | 2477 |
| 73 | Ga0123356_10096093 | 3300010049 | Bacteria | 2833 |
| 74 | Ga0123356_10828411 | 3300010049 | Bacteria | 1096 |
| 75 | Ga0123356_12624072 | 3300010049 | Bacteria | 631 |
| 76 | Ga0123353_10040321 | 3300010167 | Bacteria | 7366 |
| 77 | Ga0123353_11030368 | 3300010167 | Bacteria | 1102 |
| 78 | Ga0123353_11448926 | 3300010167 | Bacteria | 879 |
| 79 | Ga0123353_13208156 | 3300010167 | Bacteria | 524 |
| 80 | JGI24695J34938_10143786 | 3300002450 | Bacteria | 975 |
| 81 | JGI24702J35022_10000608 | 3300002462 | Bacteria | 21719 |
| 82 | Ga0068302_10219889 | 3300005071 | Bacteria | 2080 |
| 83 | Ga0466733_123746 | 3300042659 | Bacteria | 3479 |
| 84 | Ga0466728_116745 | 3300042620 | Bacteria | 4944 |
| 85 | Ga0466728_231916 | 3300042620 | Bacteria | 1201 |
| 86 | Ga0466734_075613 | 3300042623 | Bacteria | 1706 |
| 87 | Ga0466709_393246 | 3300042648 | Bacteria | 2275 |
| 88 | Ga0466727_176279 | 3300042655 | Bacteria | 1354 |
| 89 | Ga0466714_071144 | 3300042603 | Bacteria | 1071 |
| 90 | Ga0466722_044244 | 3300042609 | Bacteria | 4116 |
| 91 | Ga0123355_10003563 | 3300009826 | Bacteria | 22384 |
| 92 | Ga0123355_10064987 | 3300009826 | Unclassified | 5877 |
| 93 | Ga0123355_10183278 | 3300009826 | Bacteria | 3103 |
| 94 | Ga0123355_10213121 | 3300009826 | Bacteria | 2794 |
| 95 | Ga0123356_10197732 | 3300010049 | Bacteria | 2048 |
| 96 | Ga0123356_10793465 | 3300010049 | Bacteria | 1118 |
| 97 | Ga0123356_11674502 | 3300010049 | Bacteria | 789 |
| 98 | Ga0123353_10193676 | 3300010167 | Bacteria | 3206 |
| 99 | Ga0123353_10607777 | 3300010167 | Bacteria | 1561 |
| 100 | Ga0123353_11831398 | 3300010167 | Bacteria | 752 |
| 101 | Ga0123353_13437416 | 3300010167 | Unclassified | 501 |
| 102 | Ga0466705_099458 | 3300042612 | Bacteria | 1338 |
| 103 | Ga0466711_195067 | 3300042615 | Bacteria | 4352 |
| 104 | Ga0466715_086153 | 3300042616 | Bacteria | 1347 |
| 105 | Ga0466704_164622 | 3300042643 | Bacteria | 6539 |
| 106 | Ga0466725_372785 | 3300042654 | Bacteria | 2070 |
| 107 | Ga0466716_395861 | 3300042605 | Bacteria | 23642 |
| 108 | Ga0466719_176669 | 3300042606 | Bacteria | 2634 |
| 109 | Ga0466722_008569 | 3300042609 | Bacteria | 9082 |
| 110 | Ga0123355_10013944 | 3300009826 | Bacteria | 12532 |
| 111 | Ga0123355_10058764 | 3300009826 | Bacteria | 6219 |
| 112 | Ga0123355_10898812 | 3300009826 | Bacteria | 963 |
| 113 | Ga0123355_11239788 | 3300009826 | Unclassified | 756 |
| 114 | Ga0123356_11019168 | 3300010049 | Unclassified | 998 |
| 115 | Ga0123356_11134170 | 3300010049 | Bacteria | 949 |
| 116 | Ga0123356_11185006 | 3300010049 | Bacteria | 930 |
| 117 | Ga0123353_10133535 | 3300010167 | Bacteria | 3982 |
| 118 | Ga0123353_10171645 | 3300010167 | Bacteria | 3442 |
| 119 | Ga0123353_10234432 | 3300010167 | Bacteria | 2858 |
| 120 | Ga0123353_10730959 | 3300010167 | Bacteria | 1382 |
| 121 | Ga0123353_11065091 | 3300010167 | Bacteria | 1078 |
| 122 | Ga0123357_10000232 | 3300009784 | Bacteria | 52582 |
| 123 | Ga0466696_129425 | 3300042596 | Unclassified | 1038 |
| 124 | Ga0466705_152632 | 3300042612 | Bacteria | 6203 |
| 125 | Ga0466733_091215 | 3300042659 | Bacteria | 7210 |
| 126 | Ga0466723_056343 | 3300042618 | Bacteria | 9755 |
| 127 | Ga0466728_427407 | 3300042620 | Bacteria | 5291 |
| 128 | Ga0466729_285011 | 3300042621 | Bacteria | 12342 |
| 129 | Ga0466703_027253 | 3300042636 | Unclassified | 2239 |
| 130 | Ga0466708_462241 | 3300042652 | Bacteria | 17656 |
| 131 | Ga0466706_229281 | 3300042599 | Bacteria | 1159 |
| 132 | Ga0466707_373620 | 3300042601 | Bacteria | 1834 |
| 133 | Ga0123355_10000967 | 3300009826 | Bacteria | 39727 |
| 134 | Ga0123355_10010627 | 3300009826 | Bacteria | 14135 |
| 135 | Ga0123355_10028057 | 3300009826 | Bacteria | 9098 |
| 136 | Ga0123355_10041529 | 3300009826 | Bacteria | 7488 |
| 137 | Ga0123355_10490420 | 3300009826 | Bacteria | 1522 |
| 138 | Ga0123355_10704302 | 3300009826 | Bacteria | 1158 |
| 139 | Ga0123355_11435556 | 3300009826 | Bacteria | 679 |
| 140 | Ga0123356_10708346 | 3300010049 | Bacteria | 1176 |
| 141 | Ga0123356_11397979 | 3300010049 | Unclassified | 860 |
| 142 | Ga0123356_12193417 | 3300010049 | Bacteria | 690 |
| 143 | Ga0123353_10152153 | 3300010167 | Unclassified | 3692 |
| 144 | Ga0123353_10282012 | 3300010167 | Bacteria | 2551 |
| 145 | IMNBL1DRAFT_c0027633 | 3300000062 | Bacteria | 2129 |
| 146 | JGI24702J35022_10001954 | 3300002462 | Bacteria | 12709 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14330 | DUF4387 | Domain of unknown function (DUF4387) | 5 | 101 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.