Protein Family IF09489
Metagenome
Isolate
280
Members
222
Samples
95
Scaffolds
247.68
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_368293|Ga0466704_368293_1286_2152
- Length
- 288 aa
- Sequence
- VTPPAFPRSAGEGGPAGPEEGVHLAATNRRKNLCFLSPDEKPVKVGLFIPCYVNALHPEAGVAAYRLLEHFGVDVDYPLAQTCCGQAMANGGFESEALPLACRFDRLFRSCDYIVAPSASCVAFVREKYPEMLAKDARPCLGGGRIYELCEFLYDVLEVGEMPGHFPHKVSVHNSCHGVRGLRLSSGSELMIPRYSRIIDLLSRVDGIEILEPRRPDECCGFGGMFAVEEAAVSVCMGEDKIRNHLATGAKVVTGADSACLMHMQGIAQRERLPLRFLHVAQILAAGL
Sample Types
Isolate
66.1%
Metagenome
33.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
32.0%
Apidae
19.2%
Drosophilidae
16.9%
Blattidae
8.2%
Unclassified
6.4%
Kalotermitidae
5.9%
Rhinotermitidae
1.8%
Termopsidae
1.8%
Termitidae
1.4%
Berytidae
0.9%
Hydrophilidae
0.9%
Elmidae
0.9%
Nymphalidae
0.5%
Culicidae
0.5%
Armadillidiidae
0.5%
Hodotermitidae
0.5%
Alydidae
0.5%
Tenebrionidae
0.5%
Passalidae
0.5%
Tephritidae
0.5%
Taxonomy
Archaea
0
Bacteria
275
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 2 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 3 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 4 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 5 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 6 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 7 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 8 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 9 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 10 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 11 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 12 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 13 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 14 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 15 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 16 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 17 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 18 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 19 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 20 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 21 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 22 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 23 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 24 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 25 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 30 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 31 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 32 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 33 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 34 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 35 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 36 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 37 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 38 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 39 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 40 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 41 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 48 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 49 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 50 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 51 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 52 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 53 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 54 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 55 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 56 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 57 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 58 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 59 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 60 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 61 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 62 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 63 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 64 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 65 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 66 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 67 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 68 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 69 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 70 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 71 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 72 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 73 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 74 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 75 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 76 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 77 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 78 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 79 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 80 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 81 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 82 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 83 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 84 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 85 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 86 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 87 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 88 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 89 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 90 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 91 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 92 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 93 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 94 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 95 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 96 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 97 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 98 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 99 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 100 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 101 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 102 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 103 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 104 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 105 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 106 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 107 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 108 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 109 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 110 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 111 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 112 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 113 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 114 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 115 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 116 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 117 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 118 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 119 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 120 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 121 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 122 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 123 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 124 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 125 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 126 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 127 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 128 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 129 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 130 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 131 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 132 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 133 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 134 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 135 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 136 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 137 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 138 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 139 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 140 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 141 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 142 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 143 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 144 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 145 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 146 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 147 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 148 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 149 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 150 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 151 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 152 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 153 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 154 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 155 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 156 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 157 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 158 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 159 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 160 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 161 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 162 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 163 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 164 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 165 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 166 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 167 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 168 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 169 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 170 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 171 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 172 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 173 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 174 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 175 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 176 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 177 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 178 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 179 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 180 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 181 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 182 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 183 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 184 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 185 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 186 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 187 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 188 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 189 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 190 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 191 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 192 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 193 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 194 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 195 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 196 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 197 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 198 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 199 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 200 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 201 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 202 | 2512047014 | Acetobacter tropicalis B1.3 | Isolate | Tephritidae |
| 203 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 204 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 205 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 206 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 207 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 208 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 209 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 210 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 211 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 212 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 213 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 214 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 215 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 216 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 217 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 218 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 219 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 220 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 221 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 222 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_030501 | 3300042601 | Bacteria | 17725 |
| 2 | Ga0466707_409854 | 3300042601 | Bacteria | 5947 |
| 3 | Ga0466719_235377 | 3300042606 | Bacteria | 1837 |
| 4 | HBC_ctgsDRAFT_1000021 | 3300000333 | Bacteria | 41129 |
| 5 | Ga0466711_343868 | 3300042615 | Bacteria | 17050 |
| 6 | Ga0466715_494309 | 3300042616 | Bacteria | 6447 |
| 7 | Ga0466703_415807 | 3300042636 | Bacteria | 1691 |
| 8 | Ga0466704_244636 | 3300042643 | Bacteria | 19020 |
| 9 | Ga0466704_410800 | 3300042643 | Bacteria | 5667 |
| 10 | Ga0466709_219765 | 3300042648 | Bacteria | 5631 |
| 11 | Ga0466727_050572 | 3300042655 | Bacteria | 5938 |
| 12 | Ga0466690_035434 | 3300042590 | Bacteria | 19417 |
| 13 | Ga0466690_061009 | 3300042590 | Bacteria | 3960 |
| 14 | Ga0466691_148971 | 3300042593 | Bacteria | 4642 |
| 15 | Ga0466706_205072 | 3300042599 | Bacteria | 5235 |
| 16 | Ga0466707_074933 | 3300042601 | Bacteria | 9174 |
| 17 | Ga0466713_126571 | 3300042602 | Bacteria | 4827 |
| 18 | Ga0466719_336230 | 3300042606 | Bacteria | 6828 |
| 19 | Ga0466705_401123 | 3300042612 | Bacteria | 3950 |
| 20 | Ga0466703_028325 | 3300042636 | Bacteria | 3118 |
| 21 | Ga0466703_175800 | 3300042636 | Bacteria | 6967 |
| 22 | Ga0466703_261081 | 3300042636 | Bacteria | 5647 |
| 23 | Ga0466704_017077 | 3300042643 | Bacteria | 12951 |
| 24 | Ga0160452_100061 | 3300012834 | Bacteria | 144414 |
| 25 | Ga0466690_186066 | 3300042590 | Bacteria | 4983 |
| 26 | Ga0466690_213523 | 3300042590 | Bacteria | 18139 |
| 27 | Ga0466691_065787 | 3300042593 | Bacteria | 5120 |
| 28 | Ga0466719_010406 | 3300042606 | Bacteria | 2309 |
| 29 | Ga0466722_239940 | 3300042609 | Bacteria | 60486 |
| 30 | Ga0466711_356861 | 3300042615 | Bacteria | 4558 |
| 31 | Ga0466715_102786 | 3300042616 | Bacteria | 21811 |
| 32 | Ga0466723_151700 | 3300042618 | Bacteria | 12963 |
| 33 | Ga0466728_230496 | 3300042620 | Bacteria | 10813 |
| 34 | Ga0466729_161010 | 3300042621 | Bacteria | 14959 |
| 35 | Ga0466703_110430 | 3300042636 | Bacteria | 10993 |
| 36 | Ga0466733_188344 | 3300042659 | Bacteria | 9265 |
| 37 | Ga0123355_10213423 | 3300009826 | Bacteria | 2792 |
| 38 | Ga0160467_100783 | 3300012829 | Bacteria | 21712 |
| 39 | Ga0466692_069631 | 3300042591 | Bacteria | 1304 |
| 40 | Ga0466706_255935 | 3300042599 | Bacteria | 48242 |
| 41 | Ga0466707_113013 | 3300042601 | Bacteria | 10240 |
| 42 | Ga0074278_138249 | 3300005721 | Bacteria | 57710 |
| 43 | Ga0466735_078306 | 3300042624 | Bacteria | 1735 |
| 44 | Ga0466708_119807 | 3300042652 | Bacteria | 1465 |
| 45 | Ga0466713_020044 | 3300042602 | Bacteria | 3882 |
| 46 | Ga0466722_152891 | 3300042609 | Bacteria | 26871 |
| 47 | Ga0466722_187737 | 3300042609 | Bacteria | 3143 |
| 48 | Ga0074308_1113971 | 3300005307 | Bacteria | 2279 |
| 49 | Ga0466711_147968 | 3300042615 | Bacteria | 9655 |
| 50 | Ga0466715_514362 | 3300042616 | Bacteria | 34842 |
| 51 | Ga0466723_003516 | 3300042618 | Bacteria | 3112 |
| 52 | Ga0466723_167633 | 3300042618 | Bacteria | 11118 |
| 53 | Ga0466704_382019 | 3300042643 | Bacteria | 21752 |
| 54 | Ga0466708_196872 | 3300042652 | Bacteria | 5587 |
| 55 | Ga0160442_100009 | 3300012806 | Bacteria | 498468 |
| 56 | Ga0466690_212757 | 3300042590 | Bacteria | 11398 |
| 57 | Ga0466706_274977 | 3300042599 | Bacteria | 1190 |
| 58 | Ga0466722_052005 | 3300042609 | Bacteria | 18786 |
| 59 | Ga0074302_1003573 | 3300005316 | Unclassified | 1363 |
| 60 | Ga0466715_227792 | 3300042616 | Bacteria | 3048 |
| 61 | Ga0466715_459271 | 3300042616 | Bacteria | 28994 |
| 62 | Ga0466723_020117 | 3300042618 | Bacteria | 21671 |
| 63 | Ga0466730_065448 | 3300042625 | Bacteria | 13247 |
| 64 | Ga0466704_008179 | 3300042643 | Bacteria | 8738 |
| 65 | Ga0466709_018256 | 3300042648 | Bacteria | 49315 |
| 66 | Ga0466727_028469 | 3300042655 | Bacteria | 1171 |
| 67 | Ga0466705_103612 | 3300042612 | Bacteria | 55765 |
| 68 | Ga0160448_100481 | 3300012854 | Bacteria | 13770 |
| 69 | Ga0466690_373162 | 3300042590 | Bacteria | 16201 |
| 70 | Ga0466696_024642 | 3300042596 | Bacteria | 3435 |
| 71 | Ga0466706_170625 | 3300042599 | Bacteria | 21733 |
| 72 | Ga0466707_145573 | 3300042601 | Unclassified | 2872 |
| 73 | Ga0466719_298340 | 3300042606 | Bacteria | 1447 |
| 74 | Ga0466719_393562 | 3300042606 | Bacteria | 1844 |
| 75 | Ga0466715_379183 | 3300042616 | Bacteria | 14168 |
| 76 | Ga0466726_109943 | 3300042619 | Unclassified | 3935 |
| 77 | Ga0466728_108193 | 3300042620 | Bacteria | 15541 |
| 78 | Ga0466703_238767 | 3300042636 | Bacteria | 31663 |
| 79 | Ga0466704_368293 | 3300042643 | Bacteria | 2708 |
| 80 | Ga0466733_023942 | 3300042659 | Bacteria | 35698 |
| 81 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 82 | Ga0466696_235233 | 3300042596 | Bacteria | 8310 |
| 83 | Ga0466713_045587 | 3300042602 | Bacteria | 50252 |
| 84 | Ga0466713_079789 | 3300042602 | Bacteria | 1278 |
| 85 | IMNBL1DRAFT_c0002216 | 3300000062 | Bacteria | 13711 |
| 86 | Ga0068302_10218441 | 3300005071 | Unclassified | 2825 |
| 87 | Ga0105524_105789 | 3300007733 | Bacteria | 2029 |
| 88 | Ga0466723_004606 | 3300042618 | Bacteria | 2751 |
| 89 | Ga0466726_063492 | 3300042619 | Bacteria | 11296 |
| 90 | Ga0466728_030831 | 3300042620 | Unclassified | 2002 |
| 91 | Ga0466728_057195 | 3300042620 | Bacteria | 5908 |
| 92 | Ga0466735_001812 | 3300042624 | Bacteria | 4379 |
| 93 | Ga0466704_550461 | 3300042643 | Bacteria | 4615 |
| 94 | Ga0466709_130141 | 3300042648 | Bacteria | 11945 |
| 95 | Ga0466727_061730 | 3300042655 | Bacteria | 3749 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02754 | CCG | Cysteine-rich domain | 170 | 265 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.