Protein Family IF09478

Metagenome Isolate
152 Members
52 Samples
135 Scaffolds
217.53 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_351171|Ga0466704_351171_1101_1766
Length
221 aa
Sequence
MRTRYDEQLAILNSELIEMGALVEYAITKAVTALKGRDVESAEEVIQSDRVIDEKEKEIESLCLKLILFEQPVASDLRQVSAALKMITDLERVGDHAADISELCVYMSGNSGNEHITNWTRMRDMASAATKMLTDAIDAFVKRDPALAESVMSHDDVVDDLFDEVKRDLIRLIREDARNGEQAIDLLQIAKYLERIGDHAVNIAEWVIFSITGVHKDTQVL

📊 Sample Types

Isolate 11.2%
Metagenome 88.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.5%
Termitidae 25.5%
Kalotermitidae 23.5%
Termopsidae 7.8%
Rhinotermitidae 5.9%
Stratiomyidae 3.9%
Passalidae 3.9%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 146
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
2 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
3 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
8 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
9 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
10 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2820080004 Unclassified Proteobacteria Lab288P4bin34 Isolate Unclassified
22 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
27 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
28 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
43 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
49 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
50 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_204222 3300042616 Bacteria 10036
2 Ga0466692_027993 3300042591 Bacteria 48434
3 Ga0466706_025300 3300042599 Bacteria 10536
4 Ga0466719_336472 3300042606 Bacteria 54006
5 Ga0466722_006451 3300042609 Bacteria 12524
6 Ga0123355_10354228 3300009826 Bacteria 1941
7 Ga0123356_10625059 3300010049 Bacteria 1243
8 Ga0123356_10867557 3300010049 Bacteria 1074
9 Ga0123353_10302251 3300010167 Bacteria 2441
10 Ga0466704_308416 3300042643 Bacteria 20776
11 Ga0466704_351171 3300042643 Bacteria 2232
12 Ga0466709_131732 3300042648 Bacteria 2768
13 Ga0466727_036485 3300042655 Bacteria 9446
14 IMNBL1DRAFT_c0000504 3300000062 Bacteria 32511
15 IMNBL1DRAFT_c0000594 3300000062 Bacteria 29101
16 IMNBL1DRAFT_c0003108 3300000062 Bacteria 10953
17 IMNBL1DRAFT_c0046611 3300000062 Bacteria 1406
18 JGI24705J35276_12191409 3300002504 Bacteria 1474
19 Ga0466728_047370 3300042620 Bacteria 1402
20 Ga0415639_000016 3300038395 Bacteria 54558
21 Ga0415639_006863 3300038395 Bacteria 34048
22 Ga0466690_179867 3300042590 Bacteria 9633
23 Ga0466690_232357 3300042590 Bacteria 1366
24 Ga0466706_170801 3300042599 Unclassified 1141
25 Ga0466706_175156 3300042599 Bacteria 30160
26 Ga0466707_350391 3300042601 Bacteria 1004
27 Ga0466719_411541 3300042606 Bacteria 5788
28 Ga0123355_10133431 3300009826 Bacteria 3820
29 Ga0123355_10358181 3300009826 Bacteria 1925
30 Ga0123356_10000423 3300010049 Bacteria 48180
31 Ga0123356_10947859 3300010049 Bacteria 1032
32 Ga0123353_10371589 3300010167 Bacteria 2143
33 Ga0123353_11050647 3300010167 Bacteria 1088
34 Ga0123353_11060179 3300010167 Bacteria 1081
35 Ga0466703_276607 3300042636 Bacteria 7277
36 Ga0466708_254521 3300042652 Bacteria 46045
37 Ga0466708_447127 3300042652 Bacteria 1416
38 IMNBL1DRAFT_c0004372 3300000062 Bacteria 8525
39 Ga0466705_143755 3300042612 Bacteria 4604
40 Ga0466705_520748 3300042612 Bacteria 5715
41 Ga0466715_455412 3300042616 Bacteria 5786
42 Ga0466728_076476 3300042620 Bacteria 2635
43 Ga0466728_128678 3300042620 Unclassified 1044
44 Ga0415639_000656 3300038395 Bacteria 9483
45 Ga0466707_188343 3300042601 Bacteria 5373
46 Ga0466714_093038 3300042603 Bacteria 4466
47 Ga0123355_10587855 3300009826 Bacteria 1327
48 Ga0123353_10658318 3300010167 Bacteria 1481
49 Ga0123353_10828406 3300010167 Bacteria 1272
50 Ga0123354_10167073 3300010882 Bacteria 2581
51 Ga0466727_303889 3300042655 Bacteria 1362
52 Ga0466705_322267 3300042612 Bacteria 3028
53 Ga0466723_145743 3300042618 Bacteria 34862
54 Ga0466723_331935 3300042618 Bacteria 4212
55 Ga0466726_025579 3300042619 Bacteria 14087
56 Ga0415639_040245 3300038395 Bacteria 4619
57 Ga0466707_015371 3300042601 Bacteria 12702
58 Ga0466719_358405 3300042606 Bacteria 3026
59 Ga0466722_000591 3300042609 Bacteria 5776
60 Ga0123353_10004613 3300010167 Bacteria 17783
61 Ga0466735_208104 3300042624 Bacteria 3477
62 Ga0466703_154400 3300042636 Bacteria 7932
63 Ga0466704_386847 3300042643 Bacteria 1049
64 Ga0466704_609914 3300042643 Unclassified 16061
65 Ga0466708_250540 3300042652 Bacteria 15125
66 IMNBL1DRAFT_c0000462 3300000062 Bacteria 34022
67 IMNBL1DRAFT_c0002887 3300000062 Bacteria 11516
68 Ga0466705_244477 3300042612 Bacteria 1475
69 Ga0466705_353146 3300042612 Bacteria 2129
70 Ga0466728_280537 3300042620 Bacteria 29667
71 Ga0415639_087093 3300038395 Bacteria 4419
72 Ga0466690_103477 3300042590 Bacteria 27602
73 Ga0466693_293462 3300042592 Bacteria 1119
74 Ga0466696_272889 3300042596 Bacteria 6114
75 Ga0123355_10224294 3300009826 Bacteria 2696
76 Ga0123353_10053283 3300010167 Bacteria 6466
77 Ga0466729_203937 3300042621 Bacteria 1664
78 Ga0466703_318838 3300042636 Bacteria 3396
79 Ga0466704_371810 3300042643 Bacteria 9952
80 2227613519 2225789004 Bacteria 2243
81 JGI24703J35330_11748491 3300002501 Bacteria 17536
82 Ga0466705_103257 3300042612 Bacteria 29091
83 Ga0466728_189537 3300042620 Bacteria 1453
84 Ga0466729_046736 3300042621 Bacteria 36013
85 Ga0466691_079916 3300042593 Bacteria 13574
86 Ga0466706_213575 3300042599 Bacteria 1282
87 Ga0466706_224511 3300042599 Bacteria 8128
88 Ga0466707_077608 3300042601 Bacteria 8988
89 Ga0466722_162998 3300042609 Bacteria 2940
90 Ga0123355_10002682 3300009826 Bacteria 25237
91 Ga0123355_10007575 3300009826 Unclassified 16290
92 Ga0123353_10000230 3300010167 Bacteria 70628
93 Ga0123353_10373958 3300010167 Bacteria 2135
94 Ga0466704_293971 3300042643 Bacteria 1585
95 2227283592 2225789004 Bacteria 1255
96 2227494070 2225789004 Bacteria 20271
97 Ga0068302_10066077 3300005071 Bacteria 15811
98 Ga0466723_264624 3300042618 Bacteria 10157
99 Ga0466700_007099 3300042600 Bacteria 1018
100 Ga0466700_196512 3300042600 Bacteria 1206
101 Ga0466719_014579 3300042606 Bacteria 2880
102 Ga0466719_142314 3300042606 Bacteria 2599
103 Ga0466721_135467 3300042608 Bacteria 15102
104 Ga0123355_10834887 3300009826 Bacteria 1018
105 Ga0123356_10068072 3300010049 Bacteria 3335
106 Ga0123356_10952135 3300010049 Bacteria 1029
107 Ga0123356_11102424 3300010049 Bacteria 962
108 Ga0123353_10074966 3300010167 Unclassified 5438
109 Ga0123353_10805866 3300010167 Bacteria 1296
110 Ga0466703_210812 3300042636 Bacteria 2038
111 Ga0466715_118933 3300042616 Bacteria 4816
112 Ga0415639_056534 3300038395 Bacteria 2314
113 Ga0466696_112817 3300042596 Bacteria 1360
114 Ga0466696_152839 3300042596 Bacteria 12178
115 Ga0466706_109913 3300042599 Bacteria 2448
116 Ga0466706_183783 3300042599 Bacteria 28869
117 Ga0466700_098243 3300042600 Bacteria 1267
118 Ga0466707_083504 3300042601 Bacteria 1329
119 Ga0466719_120555 3300042606 Bacteria 8797
120 Ga0466719_165163 3300042606 Bacteria 6984
121 Ga0466719_310483 3300042606 Bacteria 1326
122 Ga0466721_258336 3300042608 Bacteria 21781
123 Ga0466722_232912 3300042609 Bacteria 13128
124 Ga0123355_10021615 3300009826 Bacteria 10301
125 Ga0123355_10033948 3300009826 Bacteria 8287
126 Ga0123355_10195651 3300009826 Bacteria 2966
127 Ga0123356_10000039 3300010049 Bacteria 138853
128 Ga0123353_10071396 3300010167 Bacteria 5578
129 Ga0123353_10387502 3300010167 Bacteria 2087
130 Ga0123353_10541536 3300010167 Bacteria 1682
131 Ga0123354_10040001 3300010882 Bacteria 7261
132 Ga0466702_319029 3300042635 Bacteria 39449
133 Ga0466708_067650 3300042652 Bacteria 28053
134 IMNBL1DRAFT_c0044026 3300000062 Bacteria 1471
135 Ga0072941_1341687 3300005201 Unclassified 4852

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01895 PhoU PhoU domain 16 103 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.