Protein Family IF09442
Metagenome
Isolate
509
Members
159
Samples
429
Scaffolds
398.39
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_265485|Ga0466704_265485_207_1544
- Length
- 445 aa
- Sequence
- MMKPFGAVVRVVLITTSCKEPEENIAFALQCYMILLNIHKNKNXSMXXXKVVLAFSGGLDTSFCSMYLSQELGYEVYTALANTGGFSEEDLKKIEERAYRLGAKKHVNLDITQEYYEKSIKYMVFGNVLRNGVYPVSVSSERIFQAIAIINYAKEIGADYVAHGSTGAGNDQVRFDLTFDVLAPEIGIITPTRDMILTREYEINYLKEHGFEADFAKMEYSINKGLWGTSIGGKETLKSGQTLPEEAYPSQLQEKGEEILKITFTGGEVTAVNGKEYPDKVNAIQEIERIASRYAIGRDMHIGDTIIGIKGRVGFEAAAPLVIINAHKMLEKHTLSKWQQYWKDQIGTWYGMFLHEAQYLEPVMRDMEAFLQSSQQNVTGTTIVQLRPYHYTLVGVESDFDLMKTDFGEYGEINRAWTPEDAKGFTKITAIPTKIYHAVQKKNGK
Sample Types
Isolate
15.7%
Metagenome
84.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
22.4%
Termitidae
16.3%
Unclassified
10.9%
Kalotermitidae
9.5%
Elmidae
5.4%
Culicidae
5.4%
Drosophilidae
4.8%
Rhinotermitidae
4.1%
Apidae
4.1%
Formicidae
3.4%
Armadillidiidae
2.7%
Termopsidae
2.7%
Passalidae
2.0%
Hydrophilidae
2.0%
Tenebrionidae
1.4%
Hodotermitidae
0.7%
Nephropidae
0.7%
Cambaridae
0.7%
Daphniidae
0.7%
Taxonomy
Archaea
0
Bacteria
496
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 3 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 4 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 5 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 6 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 7 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 8 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 11 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 16 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 17 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 18 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 19 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 20 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 21 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 22 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 23 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 24 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 27 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 43 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 44 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 45 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 46 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 47 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 48 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 49 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 50 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 51 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 52 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 53 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 54 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 55 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 56 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 57 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 58 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 59 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 60 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 61 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 62 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 63 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 64 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 65 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 66 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 67 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 68 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 71 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 72 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 73 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 74 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 75 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 81 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 82 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 83 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 84 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 85 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 86 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 87 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 88 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 89 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 90 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 91 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 92 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 93 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 94 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 95 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 96 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 97 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 98 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 99 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 100 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 101 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 102 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 103 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 104 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 105 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 106 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 107 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 108 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 109 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 110 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 111 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 112 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 113 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 114 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 115 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 116 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 117 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 118 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 119 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 120 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 121 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 122 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 123 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 124 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 125 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 126 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 127 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 128 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 129 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 130 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 131 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 132 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 133 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 134 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 135 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 136 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 137 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 138 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 139 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 140 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 141 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 142 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 143 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 144 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 145 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 146 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 147 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 148 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 149 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 150 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 151 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 152 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 153 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 154 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 155 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 156 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 157 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 158 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 159 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_156120 | 3300042612 | Bacteria | 3270 |
| 2 | Ga0466733_005030 | 3300042659 | Bacteria | 1293 |
| 3 | Ga0466705_419050 | 3300042612 | Bacteria | 11402 |
| 4 | Ga0466712_022935 | 3300042614 | Bacteria | 2628 |
| 5 | Ga0466711_025258 | 3300042615 | Bacteria | 45468 |
| 6 | Ga0466711_392107 | 3300042615 | Bacteria | 21134 |
| 7 | Ga0466715_149956 | 3300042616 | Bacteria | 15041 |
| 8 | Ga0466715_613283 | 3300042616 | Bacteria | 7780 |
| 9 | Ga0466723_023805 | 3300042618 | Bacteria | 54844 |
| 10 | Ga0466723_127060 | 3300042618 | Bacteria | 8635 |
| 11 | Ga0466726_492777 | 3300042619 | Bacteria | 10662 |
| 12 | Ga0466728_151684 | 3300042620 | Bacteria | 45808 |
| 13 | Ga0466729_144882 | 3300042621 | Bacteria | 9009 |
| 14 | Ga0160472_100034 | 3300012839 | Bacteria | 259700 |
| 15 | Ga0160445_100027 | 3300012847 | Bacteria | 190794 |
| 16 | Ga0160443_100103 | 3300012848 | Bacteria | 135933 |
| 17 | Ga0466690_064068 | 3300042590 | Bacteria | 10754 |
| 18 | Ga0466690_193047 | 3300042590 | Bacteria | 18642 |
| 19 | Ga0466692_008618 | 3300042591 | Bacteria | 8000 |
| 20 | Ga0466691_036539 | 3300042593 | Bacteria | 23739 |
| 21 | Ga0466691_108850 | 3300042593 | Bacteria | 6164 |
| 22 | Ga0466691_128816 | 3300042593 | Bacteria | 2694 |
| 23 | Ga0466706_186023 | 3300042599 | Bacteria | 49026 |
| 24 | Ga0466706_203302 | 3300042599 | Bacteria | 74431 |
| 25 | Ga0466706_254197 | 3300042599 | Bacteria | 24845 |
| 26 | Ga0466707_000450 | 3300042601 | Bacteria | 21294 |
| 27 | Ga0466713_102313 | 3300042602 | Bacteria | 97036 |
| 28 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 29 | Ga0466714_073904 | 3300042603 | Bacteria | 61298 |
| 30 | Ga0466716_386044 | 3300042605 | Bacteria | 3081 |
| 31 | Ga0466719_196375 | 3300042606 | Bacteria | 2416 |
| 32 | Ga0466719_244949 | 3300042606 | Bacteria | 12683 |
| 33 | Ga0466722_124998 | 3300042609 | Bacteria | 18940 |
| 34 | Ga0123356_10118770 | 3300010049 | Bacteria | 2568 |
| 35 | Ga0123354_10001081 | 3300010882 | Bacteria | 31466 |
| 36 | Ga0123354_10054754 | 3300010882 | Bacteria | 5980 |
| 37 | 2227494644 | 2225789004 | Bacteria | 3978 |
| 38 | HBC_ctgsDRAFT_1000008 | 3300000333 | Bacteria | 58706 |
| 39 | JGI24702J35022_10011567 | 3300002462 | Bacteria | 4917 |
| 40 | JGI24705J35276_12225143 | 3300002504 | Bacteria | 2686 |
| 41 | JGI24696J40584_12936957 | 3300002834 | Bacteria | 1592 |
| 42 | Ga0068305_10364044 | 3300005083 | Bacteria | 5119 |
| 43 | Ga0104048_1004351 | 3300007143 | Bacteria | 5930 |
| 44 | Ga0103267_1000661 | 3300007190 | Bacteria | 9530 |
| 45 | Ga0466735_009740 | 3300042624 | Bacteria | 3809 |
| 46 | Ga0466703_024117 | 3300042636 | Bacteria | 4423 |
| 47 | Ga0466703_198032 | 3300042636 | Bacteria | 3979 |
| 48 | Ga0466704_436534 | 3300042643 | Bacteria | 12457 |
| 49 | Ga0466704_505823 | 3300042643 | Bacteria | 19480 |
| 50 | Ga0466724_54741 | 3300042649 | Unclassified | 3042 |
| 51 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 52 | Ga0466725_297211 | 3300042654 | Bacteria | 2390 |
| 53 | Ga0466727_080326 | 3300042655 | Bacteria | 10492 |
| 54 | Ga0466705_236020 | 3300042612 | Bacteria | 47478 |
| 55 | Ga0466705_317509 | 3300042612 | Bacteria | 8974 |
| 56 | Ga0466711_111925 | 3300042615 | Bacteria | 13247 |
| 57 | Ga0466715_170026 | 3300042616 | Bacteria | 29950 |
| 58 | Ga0466715_473273 | 3300042616 | Bacteria | 12849 |
| 59 | Ga0466723_319751 | 3300042618 | Bacteria | 5938 |
| 60 | Ga0466726_139287 | 3300042619 | Bacteria | 7088 |
| 61 | Ga0466726_271607 | 3300042619 | Bacteria | 3044 |
| 62 | Ga0160433_100012 | 3300012846 | Bacteria | 265415 |
| 63 | Ga0160443_100057 | 3300012848 | Bacteria | 220618 |
| 64 | Ga0160435_1000020 | 3300012857 | Bacteria | 147036 |
| 65 | Ga0466690_141500 | 3300042590 | Bacteria | 4349 |
| 66 | Ga0466692_125552 | 3300042591 | Bacteria | 34821 |
| 67 | Ga0466696_042186 | 3300042596 | Bacteria | 4894 |
| 68 | Ga0466696_368481 | 3300042596 | Bacteria | 12350 |
| 69 | Ga0466701_031869 | 3300042598 | Bacteria | 13359 |
| 70 | Ga0466701_057237 | 3300042598 | Bacteria | 162355 |
| 71 | Ga0466701_102031 | 3300042598 | Bacteria | 201577 |
| 72 | Ga0466706_006525 | 3300042599 | Bacteria | 36305 |
| 73 | Ga0466707_136298 | 3300042601 | Bacteria | 30628 |
| 74 | Ga0466707_309001 | 3300042601 | Bacteria | 34578 |
| 75 | Ga0466713_019367 | 3300042602 | Bacteria | 104354 |
| 76 | Ga0466713_041042 | 3300042602 | Bacteria | 19187 |
| 77 | Ga0466713_048535 | 3300042602 | Bacteria | 16951 |
| 78 | Ga0466714_011689 | 3300042603 | Bacteria | 41248 |
| 79 | Ga0466714_082006 | 3300042603 | Bacteria | 191145 |
| 80 | Ga0466722_173883 | 3300042609 | Bacteria | 3900 |
| 81 | Ga0123357_10057285 | 3300009784 | Bacteria | 5237 |
| 82 | Ga0123357_10213684 | 3300009784 | Bacteria | 2159 |
| 83 | Ga0123353_10664810 | 3300010167 | Bacteria | 1471 |
| 84 | Ga0123354_10054259 | 3300010882 | Bacteria | 6015 |
| 85 | 2227230799 | 2225789004 | Bacteria | 7362 |
| 86 | IMNBGM34_c000880 | 3300000036 | Bacteria | 6629 |
| 87 | IMNBL1DRAFT_c0018722 | 3300000062 | Bacteria | 2865 |
| 88 | IMNBL1DRAFT_c0032664 | 3300000062 | Bacteria | 1873 |
| 89 | JGI24702J35022_10000190 | 3300002462 | Bacteria | 32930 |
| 90 | JGI24702J35022_10002753 | 3300002462 | Bacteria | 10666 |
| 91 | Meta3P_1001625 | 3300002464 | Bacteria | 10161 |
| 92 | Ga0068302_10017685 | 3300005071 | Bacteria | 2096 |
| 93 | Ga0068302_10035131 | 3300005071 | Bacteria | 6636 |
| 94 | Ga0068305_10054066 | 3300005083 | Bacteria | 9316 |
| 95 | Ga0072941_1134067 | 3300005201 | Bacteria | 6588 |
| 96 | Ga0104043_1000134 | 3300007058 | Bacteria | 4087 |
| 97 | Ga0104045_1003803 | 3300007085 | Bacteria | 9167 |
| 98 | Ga0102734_1000027 | 3300007129 | Bacteria | 62680 |
| 99 | Ga0105005_1003828 | 3300007505 | Bacteria | 3611 |
| 100 | Ga0105008_1006747 | 3300007507 | Bacteria | 9831 |
| 101 | Ga0466729_283236 | 3300042621 | Bacteria | 4772 |
| 102 | Ga0466735_130306 | 3300042624 | Bacteria | 5052 |
| 103 | Ga0466730_070302 | 3300042625 | Bacteria | 2985 |
| 104 | Ga0466703_087213 | 3300042636 | Bacteria | 7693 |
| 105 | Ga0466703_103094 | 3300042636 | Bacteria | 14416 |
| 106 | Ga0466703_175848 | 3300042636 | Bacteria | 12419 |
| 107 | Ga0466704_075067 | 3300042643 | Bacteria | 20540 |
| 108 | Ga0466709_092167 | 3300042648 | Bacteria | 4550 |
| 109 | Ga0466708_080875 | 3300042652 | Bacteria | 11455 |
| 110 | Ga0466727_119042 | 3300042655 | Bacteria | 8803 |
| 111 | Ga0466705_195954 | 3300042612 | Bacteria | 4882 |
| 112 | Ga0466733_049832 | 3300042659 | Bacteria | 6277 |
| 113 | Ga0466733_061316 | 3300042659 | Bacteria | 145079 |
| 114 | Ga0466705_448736 | 3300042612 | Bacteria | 6019 |
| 115 | Ga0466711_137330 | 3300042615 | Bacteria | 35994 |
| 116 | Ga0466711_144377 | 3300042615 | Bacteria | 12211 |
| 117 | Ga0466711_195403 | 3300042615 | Bacteria | 4104 |
| 118 | Ga0466711_198155 | 3300042615 | Bacteria | 5914 |
| 119 | Ga0466715_066720 | 3300042616 | Bacteria | 21512 |
| 120 | Ga0466715_477942 | 3300042616 | Bacteria | 11217 |
| 121 | Ga0466723_038075 | 3300042618 | Bacteria | 12663 |
| 122 | Ga0466723_241318 | 3300042618 | Bacteria | 4314 |
| 123 | Ga0466723_253031 | 3300042618 | Bacteria | 11214 |
| 124 | Ga0466726_323254 | 3300042619 | Bacteria | 2857 |
| 125 | Ga0160472_100223 | 3300012839 | Bacteria | 69349 |
| 126 | Ga0265387_1001041 | 3300024582 | Bacteria | 4131 |
| 127 | Ga0466690_090616 | 3300042590 | Bacteria | 3950 |
| 128 | Ga0466690_234657 | 3300042590 | Bacteria | 17970 |
| 129 | Ga0466693_164170 | 3300042592 | Bacteria | 1639 |
| 130 | Ga0466691_157100 | 3300042593 | Bacteria | 4736 |
| 131 | Ga0466696_028061 | 3300042596 | Bacteria | 36603 |
| 132 | Ga0466696_186658 | 3300042596 | Bacteria | 14592 |
| 133 | Ga0466701_012723 | 3300042598 | Bacteria | 34655 |
| 134 | Ga0466706_109980 | 3300042599 | Bacteria | 32685 |
| 135 | Ga0466706_110068 | 3300042599 | Bacteria | 33466 |
| 136 | Ga0466706_169288 | 3300042599 | Bacteria | 28222 |
| 137 | Ga0466706_252174 | 3300042599 | Bacteria | 4286 |
| 138 | Ga0466707_008594 | 3300042601 | Bacteria | 3185 |
| 139 | Ga0466707_079139 | 3300042601 | Unclassified | 5637 |
| 140 | Ga0466707_214355 | 3300042601 | Bacteria | 6455 |
| 141 | Ga0466713_021496 | 3300042602 | Bacteria | 25913 |
| 142 | Ga0466714_019669 | 3300042603 | Bacteria | 3899 |
| 143 | Ga0466719_007020 | 3300042606 | Bacteria | 9561 |
| 144 | Ga0466722_263608 | 3300042609 | Bacteria | 34147 |
| 145 | Ga0123357_10027806 | 3300009784 | Bacteria | 7650 |
| 146 | Ga0123356_10013145 | 3300010049 | Bacteria | 8004 |
| 147 | Ga0123353_10097501 | 3300010167 | Bacteria | 4738 |
| 148 | Ga0123353_10466082 | 3300010167 | Unclassified | 1854 |
| 149 | Ga0123354_10010510 | 3300010882 | Bacteria | 14265 |
| 150 | Ga0123354_10185122 | 3300010882 | Bacteria | 2359 |
| 151 | Ga0160470_100015 | 3300012813 | Bacteria | 326466 |
| 152 | 2227469101 | 2225789004 | Bacteria | 4977 |
| 153 | IMNBL1DRAFT_c0000056 | 3300000062 | Bacteria | 106919 |
| 154 | Ga0072941_1191167 | 3300005201 | Bacteria | 1991 |
| 155 | Ga0104048_1029032 | 3300007143 | Unclassified | 3729 |
| 156 | Ga0103264_1000022 | 3300007188 | Bacteria | 178022 |
| 157 | Ga0466735_099417 | 3300042624 | Bacteria | 2115 |
| 158 | Ga0466703_352062 | 3300042636 | Bacteria | 6366 |
| 159 | Ga0466704_265485 | 3300042643 | Bacteria | 8646 |
| 160 | Ga0466724_18481 | 3300042649 | Bacteria | 159472 |
| 161 | Ga0466724_20098 | 3300042649 | Bacteria | 21220 |
| 162 | Ga0466708_014247 | 3300042652 | Bacteria | 21773 |
| 163 | Ga0466708_079556 | 3300042652 | Bacteria | 2636 |
| 164 | Ga0466708_166283 | 3300042652 | Unclassified | 2919 |
| 165 | Ga0466708_330262 | 3300042652 | Bacteria | 27220 |
| 166 | Ga0466727_190108 | 3300042655 | Bacteria | 14426 |
| 167 | Ga0466705_133625 | 3300042612 | Bacteria | 4588 |
| 168 | Ga0466705_204274 | 3300042612 | Bacteria | 4893 |
| 169 | Ga0466733_007531 | 3300042659 | Bacteria | 3173 |
| 170 | Ga0466733_012253 | 3300042659 | Bacteria | 22612 |
| 171 | Ga0466733_107402 | 3300042659 | Bacteria | 5275 |
| 172 | Ga0466711_478800 | 3300042615 | Bacteria | 4801 |
| 173 | Ga0466715_314686 | 3300042616 | Bacteria | 14830 |
| 174 | Ga0466723_079433 | 3300042618 | Bacteria | 22184 |
| 175 | Ga0466726_088502 | 3300042619 | Bacteria | 5659 |
| 176 | Ga0466728_182270 | 3300042620 | Bacteria | 52974 |
| 177 | Ga0466728_306748 | 3300042620 | Bacteria | 24885 |
| 178 | Ga0466728_356489 | 3300042620 | Bacteria | 10989 |
| 179 | Ga0466728_483212 | 3300042620 | Bacteria | 12582 |
| 180 | Ga0466729_051045 | 3300042621 | Bacteria | 12078 |
| 181 | Ga0160445_100522 | 3300012847 | Bacteria | 18442 |
| 182 | Ga0466690_003263 | 3300042590 | Unclassified | 3220 |
| 183 | Ga0466691_010037 | 3300042593 | Bacteria | 10367 |
| 184 | Ga0466691_060905 | 3300042593 | Bacteria | 24431 |
| 185 | Ga0466696_163519 | 3300042596 | Bacteria | 6387 |
| 186 | Ga0466696_353529 | 3300042596 | Bacteria | 7911 |
| 187 | Ga0466696_443537 | 3300042596 | Bacteria | 2337 |
| 188 | Ga0466701_015101 | 3300042598 | Bacteria | 3649 |
| 189 | Ga0466706_133932 | 3300042599 | Bacteria | 8463 |
| 190 | Ga0466706_269851 | 3300042599 | Bacteria | 36528 |
| 191 | Ga0466700_376849 | 3300042600 | Bacteria | 2939 |
| 192 | Ga0466700_387454 | 3300042600 | Bacteria | 47059 |
| 193 | Ga0466707_347425 | 3300042601 | Bacteria | 8354 |
| 194 | Ga0466713_052550 | 3300042602 | Bacteria | 37670 |
| 195 | Ga0466714_131070 | 3300042603 | Bacteria | 8259 |
| 196 | Ga0466716_333412 | 3300042605 | Bacteria | 3747 |
| 197 | Ga0466716_480099 | 3300042605 | Bacteria | 3765 |
| 198 | Ga0466722_035543 | 3300042609 | Bacteria | 116913 |
| 199 | Ga0466698_021255 | 3300042610 | Bacteria | 2875 |
| 200 | Ga0466698_460920 | 3300042610 | Bacteria | 2149 |
| 201 | Ga0123356_10030209 | 3300010049 | Bacteria | 5071 |
| 202 | Ga0123353_10231833 | 3300010167 | Bacteria | 2878 |
| 203 | Ga0123354_10037335 | 3300010882 | Bacteria | 7562 |
| 204 | Ga0123354_10081131 | 3300010882 | Bacteria | 4585 |
| 205 | 2227269668 | 2225789004 | Bacteria | 6938 |
| 206 | IMNBL1DRAFT_c0004745 | 3300000062 | Bacteria | 8037 |
| 207 | IMNBL1DRAFT_c0005060 | 3300000062 | Bacteria | 7677 |
| 208 | JGI24702J35022_10024443 | 3300002462 | Bacteria | 3265 |
| 209 | JGI24705J35276_12187195 | 3300002504 | Bacteria | 1427 |
| 210 | JGI24705J35276_12228834 | 3300002504 | Bacteria | 3269 |
| 211 | JGI24699J35502_11134115 | 3300002509 | Bacteria | 32686 |
| 212 | JGI24699J35502_11134161 | 3300002509 | Bacteria | 40857 |
| 213 | JGI24696J40584_12961061 | 3300002834 | Bacteria | 10365 |
| 214 | Ga0068302_10134151 | 3300005071 | Bacteria | 1913 |
| 215 | Ga0068302_10422068 | 3300005071 | Bacteria | 2470 |
| 216 | Ga0068305_10011192 | 3300005083 | Bacteria | 12110 |
| 217 | Ga0123357_10002683 | 3300009784 | Bacteria | 20037 |
| 218 | Ga0466729_266607 | 3300042621 | Bacteria | 8002 |
| 219 | Ga0466704_066322 | 3300042643 | Bacteria | 6299 |
| 220 | Ga0466709_028246 | 3300042648 | Bacteria | 8755 |
| 221 | Ga0466708_425758 | 3300042652 | Bacteria | 4035 |
| 222 | Ga0466727_049307 | 3300042655 | Bacteria | 7513 |
| 223 | Ga0466727_267683 | 3300042655 | Bacteria | 8892 |
| 224 | Ga0466705_111016 | 3300042612 | Bacteria | 7409 |
| 225 | Ga0466705_376181 | 3300042612 | Bacteria | 3692 |
| 226 | Ga0466733_014015 | 3300042659 | Bacteria | 5810 |
| 227 | Ga0466733_025198 | 3300042659 | Bacteria | 3850 |
| 228 | Ga0466733_132399 | 3300042659 | Bacteria | 35400 |
| 229 | Ga0466733_180706 | 3300042659 | Bacteria | 2238 |
| 230 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 231 | Ga0466715_136291 | 3300042616 | Bacteria | 8831 |
| 232 | Ga0466715_190246 | 3300042616 | Bacteria | 34042 |
| 233 | Ga0466715_358298 | 3300042616 | Bacteria | 8462 |
| 234 | Ga0466715_485052 | 3300042616 | Bacteria | 31199 |
| 235 | Ga0466729_117443 | 3300042621 | Bacteria | 5076 |
| 236 | Ga0466690_013306 | 3300042590 | Bacteria | 11978 |
| 237 | Ga0466692_083609 | 3300042591 | Bacteria | 19912 |
| 238 | Ga0466696_220572 | 3300042596 | Bacteria | 15855 |
| 239 | Ga0466706_025187 | 3300042599 | Bacteria | 51793 |
| 240 | Ga0466706_064614 | 3300042599 | Bacteria | 7729 |
| 241 | Ga0466706_103955 | 3300042599 | Bacteria | 3963 |
| 242 | Ga0466707_408982 | 3300042601 | Bacteria | 3251 |
| 243 | Ga0466713_151148 | 3300042602 | Bacteria | 25657 |
| 244 | Ga0466714_075034 | 3300042603 | Bacteria | 2084 |
| 245 | Ga0466716_097496 | 3300042605 | Bacteria | 5095 |
| 246 | Ga0466719_176856 | 3300042606 | Bacteria | 5125 |
| 247 | Ga0466722_079820 | 3300042609 | Bacteria | 30245 |
| 248 | Ga0123357_10010960 | 3300009784 | Bacteria | 11575 |
| 249 | IMNBL1DRAFT_c0010654 | 3300000062 | Bacteria | 4369 |
| 250 | IMNBL1DRAFT_c0017621 | 3300000062 | Bacteria | 2998 |
| 251 | JGI24705J35276_12232638 | 3300002504 | Bacteria | 4419 |
| 252 | Ga0104041_1114393 | 3300007106 | Bacteria | 1451 |
| 253 | Ga0466729_253681 | 3300042621 | Bacteria | 12901 |
| 254 | Ga0466731_136611 | 3300042622 | Bacteria | 2645 |
| 255 | Ga0466730_079418 | 3300042625 | Bacteria | 679131 |
| 256 | Ga0466703_097578 | 3300042636 | Bacteria | 6295 |
| 257 | Ga0466703_114450 | 3300042636 | Bacteria | 5480 |
| 258 | Ga0466703_200056 | 3300042636 | Bacteria | 21401 |
| 259 | Ga0466703_290810 | 3300042636 | Bacteria | 37344 |
| 260 | Ga0466704_200286 | 3300042643 | Bacteria | 8231 |
| 261 | Ga0466704_338392 | 3300042643 | Bacteria | 4554 |
| 262 | Ga0466709_270482 | 3300042648 | Bacteria | 5513 |
| 263 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 264 | Ga0466708_012751 | 3300042652 | Bacteria | 23241 |
| 265 | Ga0466708_153133 | 3300042652 | Bacteria | 22753 |
| 266 | Ga0466732_201541 | 3300042656 | Bacteria | 48485 |
| 267 | Ga0466733_037463 | 3300042659 | Bacteria | 2794 |
| 268 | Ga0466733_123170 | 3300042659 | Bacteria | 64337 |
| 269 | Ga0466733_130895 | 3300042659 | Bacteria | 6681 |
| 270 | Ga0466733_200449 | 3300042659 | Bacteria | 3969 |
| 271 | Ga0466723_108082 | 3300042618 | Bacteria | 9241 |
| 272 | Ga0466726_170449 | 3300042619 | Bacteria | 3008 |
| 273 | Ga0466728_105393 | 3300042620 | Bacteria | 69081 |
| 274 | Ga0466728_278489 | 3300042620 | Bacteria | 5380 |
| 275 | Ga0466728_325649 | 3300042620 | Bacteria | 7234 |
| 276 | Ga0466690_177855 | 3300042590 | Bacteria | 9617 |
| 277 | Ga0466692_008187 | 3300042591 | Bacteria | 121981 |
| 278 | Ga0466692_009647 | 3300042591 | Bacteria | 10786 |
| 279 | Ga0466692_193310 | 3300042591 | Bacteria | 49575 |
| 280 | Ga0466692_195855 | 3300042591 | Bacteria | 3990 |
| 281 | Ga0466691_100152 | 3300042593 | Bacteria | 3149 |
| 282 | Ga0466691_133025 | 3300042593 | Bacteria | 5886 |
| 283 | Ga0466701_020563 | 3300042598 | Unclassified | 1504 |
| 284 | Ga0466706_203102 | 3300042599 | Bacteria | 35690 |
| 285 | Ga0466707_160373 | 3300042601 | Bacteria | 6916 |
| 286 | Ga0466713_068226 | 3300042602 | Bacteria | 7940 |
| 287 | Ga0466716_370868 | 3300042605 | Bacteria | 19469 |
| 288 | Ga0466719_061154 | 3300042606 | Bacteria | 6149 |
| 289 | Ga0466719_134177 | 3300042606 | Bacteria | 2077 |
| 290 | Ga0466719_209125 | 3300042606 | Bacteria | 3289 |
| 291 | Ga0466719_569925 | 3300042606 | Bacteria | 7264 |
| 292 | Ga0466722_003387 | 3300042609 | Bacteria | 27001 |
| 293 | Ga0466722_043264 | 3300042609 | Bacteria | 4667 |
| 294 | Ga0466722_214684 | 3300042609 | Bacteria | 3674 |
| 295 | Ga0123357_10022462 | 3300009784 | Bacteria | 8457 |
| 296 | Ga0123354_10004372 | 3300010882 | Bacteria | 20004 |
| 297 | Ga0123354_10028332 | 3300010882 | Bacteria | 8820 |
| 298 | Ga0160466_100006 | 3300012809 | Bacteria | 498369 |
| 299 | IMNBL1DRAFT_c0002288 | 3300000062 | Bacteria | 13463 |
| 300 | IMNBL1DRAFT_c0006127 | 3300000062 | Unclassified | 6660 |
| 301 | IMNBL1DRAFT_c0019297 | 3300000062 | Bacteria | 2799 |
| 302 | JGI24698J34947_10030403 | 3300002449 | Bacteria | 2848 |
| 303 | JGI24702J35022_10001899 | 3300002462 | Bacteria | 12851 |
| 304 | JGI24705J35276_12231924 | 3300002504 | Bacteria | 4116 |
| 305 | JGI24699J35502_11134231 | 3300002509 | Bacteria | 105586 |
| 306 | Ga0068305_10304430 | 3300005083 | Bacteria | 4660 |
| 307 | Ga0102740_1001693 | 3300007140 | Bacteria | 5415 |
| 308 | Ga0104048_1002749 | 3300007143 | Bacteria | 4788 |
| 309 | Ga0466730_053826 | 3300042625 | Bacteria | 92011 |
| 310 | Ga0466703_089142 | 3300042636 | Bacteria | 4900 |
| 311 | Ga0466704_058431 | 3300042643 | Bacteria | 15073 |
| 312 | Ga0466704_075678 | 3300042643 | Bacteria | 7358 |
| 313 | Ga0466704_381269 | 3300042643 | Bacteria | 8654 |
| 314 | Ga0466704_406582 | 3300042643 | Bacteria | 13152 |
| 315 | Ga0466704_536217 | 3300042643 | Bacteria | 2936 |
| 316 | Ga0466709_011326 | 3300042648 | Bacteria | 23746 |
| 317 | Ga0466709_054036 | 3300042648 | Bacteria | 25368 |
| 318 | Ga0466724_36635 | 3300042649 | Bacteria | 20132 |
| 319 | Ga0466705_038925 | 3300042612 | Bacteria | 3472 |
| 320 | Ga0466733_019879 | 3300042659 | Bacteria | 13716 |
| 321 | Ga0466733_202351 | 3300042659 | Bacteria | 83787 |
| 322 | Ga0466710_188848 | 3300042613 | Bacteria | 2502 |
| 323 | Ga0466711_422047 | 3300042615 | Bacteria | 3251 |
| 324 | Ga0466715_019255 | 3300042616 | Bacteria | 20255 |
| 325 | Ga0466715_181834 | 3300042616 | Bacteria | 9568 |
| 326 | Ga0466715_183631 | 3300042616 | Bacteria | 24353 |
| 327 | Ga0466715_448671 | 3300042616 | Bacteria | 9901 |
| 328 | Ga0466726_030060 | 3300042619 | Bacteria | 20392 |
| 329 | Ga0160453_100007 | 3300012814 | Bacteria | 330009 |
| 330 | Ga0160453_100210 | 3300012814 | Bacteria | 56854 |
| 331 | Ga0160452_100568 | 3300012834 | Bacteria | 21252 |
| 332 | Ga0160457_1001115 | 3300012858 | Bacteria | 8337 |
| 333 | Ga0466657_198621 | 3300042582 | Bacteria | 3870 |
| 334 | Ga0466690_079211 | 3300042590 | Bacteria | 4025 |
| 335 | Ga0466690_099393 | 3300042590 | Bacteria | 94849 |
| 336 | Ga0466690_120225 | 3300042590 | Bacteria | 2460 |
| 337 | Ga0466692_069541 | 3300042591 | Bacteria | 2539 |
| 338 | Ga0466691_009362 | 3300042593 | Bacteria | 25845 |
| 339 | Ga0466696_031717 | 3300042596 | Bacteria | 4905 |
| 340 | Ga0466706_106204 | 3300042599 | Bacteria | 73373 |
| 341 | Ga0466700_007622 | 3300042600 | Bacteria | 19020 |
| 342 | Ga0466700_391999 | 3300042600 | Bacteria | 5430 |
| 343 | Ga0466707_126179 | 3300042601 | Bacteria | 55735 |
| 344 | Ga0466713_081773 | 3300042602 | Bacteria | 94516 |
| 345 | Ga0466713_119741 | 3300042602 | Bacteria | 23414 |
| 346 | Ga0466714_010700 | 3300042603 | Bacteria | 109081 |
| 347 | Ga0466719_504364 | 3300042606 | Bacteria | 6374 |
| 348 | Ga0466719_525073 | 3300042606 | Bacteria | 16045 |
| 349 | Ga0466722_082297 | 3300042609 | Bacteria | 9156 |
| 350 | Ga0466722_240450 | 3300042609 | Bacteria | 8464 |
| 351 | Ga0123357_10065179 | 3300009784 | Bacteria | 4865 |
| 352 | IMNBGM34_c000849 | 3300000036 | Bacteria | 6839 |
| 353 | Ga0104050_1026731 | 3300007153 | Bacteria | 2914 |
| 354 | Ga0466735_021483 | 3300042624 | Bacteria | 8462 |
| 355 | Ga0466735_080160 | 3300042624 | Bacteria | 3412 |
| 356 | Ga0466703_086970 | 3300042636 | Bacteria | 15652 |
| 357 | Ga0466703_198609 | 3300042636 | Bacteria | 8838 |
| 358 | Ga0466703_422052 | 3300042636 | Bacteria | 8727 |
| 359 | Ga0466704_050220 | 3300042643 | Bacteria | 8094 |
| 360 | Ga0466704_098833 | 3300042643 | Bacteria | 3110 |
| 361 | Ga0466708_016632 | 3300042652 | Bacteria | 33440 |
| 362 | Ga0466708_151884 | 3300042652 | Bacteria | 2527 |
| 363 | Ga0466708_224946 | 3300042652 | Bacteria | 22929 |
| 364 | Ga0466725_443387 | 3300042654 | Bacteria | 4647 |
| 365 | Ga0466727_108549 | 3300042655 | Bacteria | 17021 |
| 366 | Ga0466727_153004 | 3300042655 | Bacteria | 5448 |
| 367 | Ga0466733_024711 | 3300042659 | Bacteria | 63451 |
| 368 | Ga0466733_036819 | 3300042659 | Bacteria | 26430 |
| 369 | Ga0466733_111702 | 3300042659 | Bacteria | 14117 |
| 370 | Ga0466733_162571 | 3300042659 | Bacteria | 74751 |
| 371 | Ga0466733_207009 | 3300042659 | Bacteria | 10181 |
| 372 | Ga0466705_523645 | 3300042612 | Bacteria | 11515 |
| 373 | Ga0466711_029229 | 3300042615 | Bacteria | 3574 |
| 374 | Ga0466711_161163 | 3300042615 | Bacteria | 17839 |
| 375 | Ga0466711_231558 | 3300042615 | Bacteria | 14810 |
| 376 | Ga0466715_073719 | 3300042616 | Unclassified | 1655 |
| 377 | Ga0466715_330431 | 3300042616 | Bacteria | 33560 |
| 378 | Ga0466728_324049 | 3300042620 | Bacteria | 45950 |
| 379 | Ga0466690_018963 | 3300042590 | Bacteria | 4110 |
| 380 | Ga0466690_180282 | 3300042590 | Bacteria | 25954 |
| 381 | Ga0466690_336420 | 3300042590 | Bacteria | 10674 |
| 382 | Ga0466692_183742 | 3300042591 | Bacteria | 15201 |
| 383 | Ga0466696_163360 | 3300042596 | Bacteria | 29150 |
| 384 | Ga0466701_015013 | 3300042598 | Unclassified | 31022 |
| 385 | Ga0466707_354392 | 3300042601 | Bacteria | 12097 |
| 386 | Ga0466713_058555 | 3300042602 | Bacteria | 16728 |
| 387 | Ga0466713_083344 | 3300042602 | Bacteria | 8774 |
| 388 | Ga0466713_115947 | 3300042602 | Bacteria | 14323 |
| 389 | Ga0466713_151326 | 3300042602 | Bacteria | 4035 |
| 390 | Ga0466714_016797 | 3300042603 | Unclassified | 2617 |
| 391 | Ga0466714_022590 | 3300042603 | Bacteria | 4972 |
| 392 | Ga0466714_026555 | 3300042603 | Bacteria | 7817 |
| 393 | Ga0466714_076630 | 3300042603 | Bacteria | 2645 |
| 394 | Ga0466714_110355 | 3300042603 | Bacteria | 2399 |
| 395 | Ga0466714_127289 | 3300042603 | Bacteria | 51946 |
| 396 | Ga0466717_109552 | 3300042604 | Bacteria | 5643 |
| 397 | Ga0466716_038569 | 3300042605 | Bacteria | 11326 |
| 398 | Ga0466716_114092 | 3300042605 | Bacteria | 13384 |
| 399 | Ga0466716_441587 | 3300042605 | Bacteria | 5758 |
| 400 | Ga0466719_313295 | 3300042606 | Bacteria | 15821 |
| 401 | Ga0466722_103772 | 3300042609 | Bacteria | 7782 |
| 402 | Ga0466722_153132 | 3300042609 | Bacteria | 3866 |
| 403 | Ga0466698_477350 | 3300042610 | Bacteria | 2082 |
| 404 | Ga0123353_10253621 | 3300010167 | Bacteria | 2723 |
| 405 | Ga0123353_10443950 | 3300010167 | Unclassified | 1913 |
| 406 | Ga0123354_10000834 | 3300010882 | Bacteria | 33977 |
| 407 | Ga0160465_100020 | 3300012803 | Bacteria | 253724 |
| 408 | 2227560738 | 2225789004 | Bacteria | 14473 |
| 409 | IMNBL1DRAFT_c0000168 | 3300000062 | Bacteria | 58839 |
| 410 | IMNBL1DRAFT_c0024312 | 3300000062 | Bacteria | 2352 |
| 411 | JGI24699J35502_11134180 | 3300002509 | Bacteria | 46233 |
| 412 | Ga0068305_10032167 | 3300005083 | Bacteria | 15858 |
| 413 | Ga0103265_1000003 | 3300007068 | Bacteria | 137272 |
| 414 | Ga0104045_1004602 | 3300007085 | Bacteria | 2766 |
| 415 | Ga0102734_1001011 | 3300007129 | Bacteria | 7756 |
| 416 | Ga0104048_1003123 | 3300007143 | Bacteria | 4694 |
| 417 | Ga0104048_1004130 | 3300007143 | Bacteria | 22073 |
| 418 | Ga0104048_1022162 | 3300007143 | Bacteria | 11480 |
| 419 | Ga0123357_10002062 | 3300009784 | Bacteria | 22044 |
| 420 | Ga0466703_038363 | 3300042636 | Bacteria | 13292 |
| 421 | Ga0466703_107975 | 3300042636 | Bacteria | 9192 |
| 422 | Ga0466704_486621 | 3300042643 | Bacteria | 6328 |
| 423 | Ga0466704_584060 | 3300042643 | Bacteria | 9421 |
| 424 | Ga0466709_051565 | 3300042648 | Bacteria | 3263 |
| 425 | Ga0466709_083589 | 3300042648 | Bacteria | 89292 |
| 426 | Ga0466725_333563 | 3300042654 | Bacteria | 10015 |
| 427 | Ga0466727_188460 | 3300042655 | Bacteria | 6030 |
| 428 | Ga0466727_279491 | 3300042655 | Unclassified | 3123 |
| 429 | Ga0466727_319003 | 3300042655 | Bacteria | 50861 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.