Protein Family IF09440
Metagenome
Isolate
218
Members
144
Samples
143
Scaffolds
266.82
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_260247|Ga0466704_260247_1818_2774
- Length
- 318 aa
- Sequence
- MPGSSHGGLCFGFSESRRFSSRPFYWDGARKKTPAATDQPPFGTMTDSCFLAASMKPYLELMRHVVEHGALKSDRTGTGTRSVFGWQMRFDLAAGFPLLTTKKLHLKSIVHELLWFLRGDTNIHYLEENGVRIWNEWADAGGDLGPIYGHQWRHWKTPDGREIDQIGELVNGLKRNPDSRRHLVTAWNPADIGRMALPPCHVLFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTLMLAQVCDYRAGDFVHTFGDAHLYDSHLEQARRQLAREPRPLPAMRINRHVTDIFAFRFEDFVLEGYDPWPHIAAPVAV
Sample Types
Isolate
34.4%
Metagenome
65.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
17.2%
Elmidae
9.7%
Muscidae
9.7%
Kalotermitidae
9.7%
Unclassified
9.0%
Calliphoridae
5.2%
Drosophilidae
5.2%
Armadillidiidae
4.5%
Sarcophagidae
3.7%
Culicidae
3.7%
Tenebrionidae
3.0%
Apidae
2.2%
Rhinotermitidae
2.2%
Passalidae
2.2%
Aphididae
1.5%
Tephritidae
1.5%
Nephropidae
1.5%
Termopsidae
1.5%
Daphniidae
0.7%
Hodotermitidae
0.7%
Cerambycidae
0.7%
Pentatomidae
0.7%
Scarabaeidae
0.7%
Bombycidae
0.7%
Cambaridae
0.7%
Hydrophilidae
0.7%
Anthomyiidae
0.7%
Taxonomy
Archaea
0
Bacteria
203
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 2 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 3 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 4 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 5 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 6 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 7 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 8 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 9 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 10 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 11 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 12 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 23 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 24 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 25 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 26 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 27 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 28 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 29 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 30 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 31 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 47 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 48 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 49 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 50 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 51 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 52 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 53 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 54 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 55 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 56 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 57 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 58 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 59 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 60 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 61 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 62 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 63 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 64 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 65 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 69 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 70 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 71 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 72 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 73 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 74 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 75 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 76 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 77 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 78 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 79 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 80 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 81 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 82 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 83 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 84 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 85 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 86 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 87 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 88 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 89 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 90 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 91 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 92 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 93 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 94 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 95 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 96 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 97 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 98 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 99 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 100 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 101 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 102 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 103 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 104 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 105 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 106 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 107 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 108 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 109 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 110 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 111 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 112 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 113 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 114 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 115 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 116 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 117 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 118 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 119 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 120 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 121 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 122 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 123 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 124 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 125 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 126 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 127 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 128 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 129 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 130 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 131 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 132 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 133 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 134 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 135 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 136 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 137 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 138 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 139 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 140 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 141 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 142 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 143 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 144 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_077973 | 3300042602 | Bacteria | 33468 |
| 2 | Ga0466719_335720 | 3300042606 | Bacteria | 14594 |
| 3 | Ga0466705_505394 | 3300042612 | Bacteria | 13088 |
| 4 | Ga0466723_232821 | 3300042618 | Bacteria | 24451 |
| 5 | Ga0123357_10047332 | 3300009784 | Bacteria | 5829 |
| 6 | Ga0123357_10072928 | 3300009784 | Bacteria | 4547 |
| 7 | Ga0123353_10029330 | 3300010167 | Bacteria | 8477 |
| 8 | Ga0123353_10988169 | 3300010167 | Bacteria | 1133 |
| 9 | Ga0466704_242414 | 3300042643 | Bacteria | 10846 |
| 10 | IMNBGM34_c005055 | 3300000036 | Bacteria | 1758 |
| 11 | Ga0104019_1002888 | 3300007150 | Unclassified | 2756 |
| 12 | Ga0105005_1004815 | 3300007505 | Bacteria | 2711 |
| 13 | Ga0160441_101777 | 3300012825 | Bacteria | 5538 |
| 14 | Ga0160455_100035 | 3300012837 | Bacteria | 309778 |
| 15 | Ga0160433_103090 | 3300012846 | Bacteria | 3184 |
| 16 | Ga0466693_080695 | 3300042592 | Bacteria | 3490 |
| 17 | Ga0466701_011763 | 3300042598 | Bacteria | 193356 |
| 18 | Ga0466707_406661 | 3300042601 | Bacteria | 2659 |
| 19 | Ga0466713_150165 | 3300042602 | Bacteria | 4270 |
| 20 | Ga0466714_158829 | 3300042603 | Bacteria | 3506 |
| 21 | Ga0466710_176688 | 3300042613 | Bacteria | 2676 |
| 22 | Ga0466728_366956 | 3300042620 | Bacteria | 2139 |
| 23 | Ga0123353_10179956 | 3300010167 | Bacteria | 3348 |
| 24 | Ga0123353_10300411 | 3300010167 | Bacteria | 2451 |
| 25 | Ga0466735_103890 | 3300042624 | Bacteria | 7453 |
| 26 | Ga0466704_040230 | 3300042643 | Bacteria | 2869 |
| 27 | 2212251853 | 2209111004 | Unclassified | 6817 |
| 28 | Ga0104050_1006273 | 3300007153 | Unclassified | 19568 |
| 29 | Ga0160452_100110 | 3300012834 | Bacteria | 105575 |
| 30 | Ga0160433_100049 | 3300012846 | Bacteria | 134813 |
| 31 | Ga0160445_100636 | 3300012847 | Bacteria | 14748 |
| 32 | Ga0466696_080493 | 3300042596 | Bacteria | 5804 |
| 33 | Ga0466705_056072 | 3300042612 | Bacteria | 34934 |
| 34 | Ga0466713_046353 | 3300042602 | Bacteria | 12193 |
| 35 | Ga0466713_122186 | 3300042602 | Bacteria | 17261 |
| 36 | Ga0466716_083044 | 3300042605 | Bacteria | 7800 |
| 37 | Ga0466722_018743 | 3300042609 | Unclassified | 2597 |
| 38 | Ga0466710_314584 | 3300042613 | Bacteria | 20595 |
| 39 | Ga0466715_371394 | 3300042616 | Bacteria | 8772 |
| 40 | Ga0466734_098942 | 3300042623 | Bacteria | 1403 |
| 41 | Ga0466704_214429 | 3300042643 | Bacteria | 21126 |
| 42 | Ga0466704_284544 | 3300042643 | Bacteria | 7461 |
| 43 | Ga0466704_583217 | 3300042643 | Bacteria | 2643 |
| 44 | Ga0104045_1004705 | 3300007085 | Bacteria | 3300 |
| 45 | Ga0104045_1019203 | 3300007085 | Bacteria | 15886 |
| 46 | Ga0160469_101349 | 3300012824 | Bacteria | 6770 |
| 47 | Ga0160472_100177 | 3300012839 | Bacteria | 85140 |
| 48 | Ga0160435_1000040 | 3300012857 | Unclassified | 105033 |
| 49 | Ga0160435_1008693 | 3300012857 | Bacteria | 2180 |
| 50 | Ga0466690_096413 | 3300042590 | Bacteria | 38967 |
| 51 | Ga0466690_224045 | 3300042590 | Bacteria | 6869 |
| 52 | Ga0466694_153919 | 3300042594 | Bacteria | 8677 |
| 53 | Ga0466705_192158 | 3300042612 | Bacteria | 4378 |
| 54 | Ga0466701_040622 | 3300042598 | Bacteria | 282607 |
| 55 | Ga0466707_228041 | 3300042601 | Bacteria | 2861 |
| 56 | Ga0466719_277586 | 3300042606 | Bacteria | 3866 |
| 57 | Ga0466697_038775 | 3300042611 | Bacteria | 1150 |
| 58 | Ga0466723_189559 | 3300042618 | Bacteria | 7492 |
| 59 | Ga0466726_114337 | 3300042619 | Bacteria | 4291 |
| 60 | Ga0123356_10143512 | 3300010049 | Bacteria | 2359 |
| 61 | Ga0123353_10282561 | 3300010167 | Bacteria | 2548 |
| 62 | Ga0123354_10017808 | 3300010882 | Bacteria | 11129 |
| 63 | Ga0123354_10283308 | 3300010882 | Bacteria | 1604 |
| 64 | Ga0466730_073669 | 3300042625 | Bacteria | 406091 |
| 65 | Ga0466704_252991 | 3300042643 | Bacteria | 1295 |
| 66 | Ga0466725_386892 | 3300042654 | Bacteria | 39515 |
| 67 | JGI24705J35276_12226156 | 3300002504 | Bacteria | 2817 |
| 68 | Ga0160441_100077 | 3300012825 | Bacteria | 120763 |
| 69 | Ga0160445_108808 | 3300012847 | Unclassified | 1542 |
| 70 | Ga0160443_105726 | 3300012848 | Bacteria | 1674 |
| 71 | Ga0466706_114094 | 3300042599 | Bacteria | 1893 |
| 72 | Ga0466707_034885 | 3300042601 | Bacteria | 3650 |
| 73 | Ga0466713_068359 | 3300042602 | Unclassified | 2481 |
| 74 | Ga0466713_077829 | 3300042602 | Bacteria | 8108 |
| 75 | Ga0123353_10235459 | 3300010167 | Bacteria | 2850 |
| 76 | Ga0123354_10256837 | 3300010882 | Bacteria | 1755 |
| 77 | Ga0466735_121786 | 3300042624 | Bacteria | 9397 |
| 78 | Ga0466702_143254 | 3300042635 | Bacteria | 1811 |
| 79 | Ga0466703_015358 | 3300042636 | Bacteria | 4927 |
| 80 | Ga0466704_260247 | 3300042643 | Bacteria | 3430 |
| 81 | Ga0466708_245414 | 3300042652 | Bacteria | 2622 |
| 82 | 2227619072 | 2225789004 | Bacteria | 11846 |
| 83 | HBC_ctgsDRAFT_1000324 | 3300000333 | Bacteria | 10931 |
| 84 | Ga0160469_100658 | 3300012824 | Bacteria | 13409 |
| 85 | Ga0160472_103500 | 3300012839 | Bacteria | 3080 |
| 86 | Ga0466656_385622 | 3300042550 | Bacteria | 1083 |
| 87 | Ga0466657_003061 | 3300042582 | Bacteria | 13461 |
| 88 | Ga0466690_084453 | 3300042590 | Bacteria | 13010 |
| 89 | Ga0466690_152536 | 3300042590 | Bacteria | 6504 |
| 90 | Ga0466690_338192 | 3300042590 | Bacteria | 2620 |
| 91 | Ga0466691_139990 | 3300042593 | Bacteria | 2538 |
| 92 | Ga0466701_001616 | 3300042598 | Unclassified | 10261 |
| 93 | Ga0466733_146778 | 3300042659 | Bacteria | 15058 |
| 94 | Ga0466719_197458 | 3300042606 | Bacteria | 4575 |
| 95 | Ga0466729_051825 | 3300042621 | Bacteria | 3135 |
| 96 | Ga0466703_175134 | 3300042636 | Bacteria | 4375 |
| 97 | Ga0466704_255980 | 3300042643 | Bacteria | 1724 |
| 98 | Ga0466709_287029 | 3300042648 | Bacteria | 41744 |
| 99 | Ga0072940_1040685 | 3300005200 | Bacteria | 7506 |
| 100 | Ga0104045_1004093 | 3300007085 | Bacteria | 2094 |
| 101 | Ga0104019_1000542 | 3300007150 | Unclassified | 8292 |
| 102 | Ga0160446_100006 | 3300012835 | Bacteria | 445354 |
| 103 | Ga0160445_112401 | 3300012847 | Unclassified | 1220 |
| 104 | Ga0160434_100794 | 3300012850 | Unclassified | 7040 |
| 105 | Ga0160448_101320 | 3300012854 | Bacteria | 8040 |
| 106 | Ga0466696_005934 | 3300042596 | Bacteria | 15675 |
| 107 | Ga0466714_111958 | 3300042603 | Bacteria | 1421 |
| 108 | Ga0466722_037594 | 3300042609 | Bacteria | 1660 |
| 109 | Ga0466710_333835 | 3300042613 | Bacteria | 1731 |
| 110 | Ga0466726_100461 | 3300042619 | Bacteria | 4006 |
| 111 | Ga0123356_10610888 | 3300010049 | Bacteria | 1256 |
| 112 | Ga0466703_318108 | 3300042636 | Bacteria | 1339 |
| 113 | Ga0466724_33472 | 3300042649 | Bacteria | 20011 |
| 114 | Ga0466724_51308 | 3300042649 | Unclassified | 1337 |
| 115 | IMNBL1DRAFT_c0009155 | 3300000062 | Bacteria | 4934 |
| 116 | JGI24695J34938_10011719 | 3300002450 | Bacteria | 4705 |
| 117 | JGI24705J35276_12229141 | 3300002504 | Bacteria | 3327 |
| 118 | Ga0104045_1074389 | 3300007085 | Bacteria | 3425 |
| 119 | Ga0104050_1002915 | 3300007153 | Bacteria | 10340 |
| 120 | Ga0104147_1016545 | 3300007224 | Bacteria | 24604 |
| 121 | Ga0160445_117382 | 3300012847 | Bacteria | 977 |
| 122 | Ga0264413_109877 | 3300024493 | Bacteria | 12886 |
| 123 | Ga0466692_169654 | 3300042591 | Bacteria | 21508 |
| 124 | Ga0466696_164269 | 3300042596 | Bacteria | 8226 |
| 125 | Ga0466697_066390 | 3300042611 | Bacteria | 1110 |
| 126 | Ga0562375_0230 | 3300056856 | Bacteria | 154058 |
| 127 | Ga0466701_034533 | 3300042598 | Bacteria | 8728 |
| 128 | Ga0466707_380189 | 3300042601 | Bacteria | 45975 |
| 129 | Ga0466714_074198 | 3300042603 | Bacteria | 829090 |
| 130 | Ga0466717_268411 | 3300042604 | Bacteria | 5583 |
| 131 | Ga0466722_158667 | 3300042609 | Bacteria | 39485 |
| 132 | Ga0466726_091418 | 3300042619 | Bacteria | 2445 |
| 133 | Ga0466728_059237 | 3300042620 | Bacteria | 41009 |
| 134 | Ga0466729_128836 | 3300042621 | Bacteria | 18713 |
| 135 | Ga0123353_10117545 | 3300010167 | Bacteria | 4277 |
| 136 | Ga0123353_10531032 | 3300010167 | Bacteria | 1703 |
| 137 | Ga0123354_10148075 | 3300010882 | Bacteria | 2861 |
| 138 | Ga0466703_352822 | 3300042636 | Bacteria | 3109 |
| 139 | Ga0466724_38298 | 3300042649 | Unclassified | 11522 |
| 140 | Ga0074308_1116106 | 3300005307 | Unclassified | 1213 |
| 141 | Ga0104043_1012864 | 3300007058 | Unclassified | 1560 |
| 142 | Ga0104045_1006313 | 3300007085 | Bacteria | 22630 |
| 143 | Ga0160444_106535 | 3300012841 | Bacteria | 1517 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00303 | Thymidylat_synt | Thymidylate synthase | 57 | 318 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.