Protein Family IF09400
Metagenome
Isolate
113
Members
39
Samples
110
Scaffolds
113.38
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_161559|Ga0466704_161559_628_987
- Length
- 108 aa
- Sequence
- MKQSEIWLIDLDPTIGAEMRKTRPALIVNDDALGRLPLKIIVPITDWKDHYSIAPGLVKTSSIDCFQIRSVSEKRLVKQLGKITNEELIKVQESINKVLLRCGVPFLE
Sample Types
Isolate
2.6%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.5%
Kalotermitidae
29.7%
Unclassified
13.5%
Rhinotermitidae
8.1%
Termopsidae
8.1%
Taxonomy
Archaea
0
Bacteria
96
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 17 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 21 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 22 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 23 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 24 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_239454 | 3300042612 | Bacteria | 13578 |
| 2 | Ga0466699_130590 | 3300042597 | Unclassified | 3182 |
| 3 | Ga0466699_144294 | 3300042597 | Unclassified | 1363 |
| 4 | Ga0466712_105815 | 3300042614 | Unclassified | 3610 |
| 5 | Ga0466726_120963 | 3300042619 | Bacteria | 1188 |
| 6 | Ga0466728_161378 | 3300042620 | Bacteria | 1167 |
| 7 | AustNasuHG_c1029486 | 3300000089 | Unclassified | 1606 |
| 8 | JGI24698J34947_10021683 | 3300002449 | Bacteria | 3451 |
| 9 | JGI24698J34947_10029448 | 3300002449 | Bacteria | 2900 |
| 10 | JGI24698J34947_10085196 | 3300002449 | Bacteria | 1469 |
| 11 | Ga0466735_150455 | 3300042624 | Bacteria | 1189 |
| 12 | Ga0466704_161559 | 3300042643 | Bacteria | 2231 |
| 13 | Ga0466704_163444 | 3300042643 | Bacteria | 1306 |
| 14 | Ga0466727_239879 | 3300042655 | Bacteria | 1249 |
| 15 | Ga0466707_005259 | 3300042601 | Bacteria | 1696 |
| 16 | Ga0466707_098141 | 3300042601 | Bacteria | 11087 |
| 17 | Ga0466692_060491 | 3300042591 | Unclassified | 1359 |
| 18 | Ga0466699_415385 | 3300042597 | Unclassified | 1969 |
| 19 | Ga0466712_040024 | 3300042614 | Bacteria | 1835 |
| 20 | Ga0466712_148912 | 3300042614 | Bacteria | 6562 |
| 21 | Ga0466712_161558 | 3300042614 | Bacteria | 10810 |
| 22 | Ga0466715_444967 | 3300042616 | Bacteria | 1692 |
| 23 | Ga0466729_173355 | 3300042621 | Bacteria | 2408 |
| 24 | JGI24698J34947_10020211 | 3300002449 | Bacteria | 3589 |
| 25 | Ga0466727_284260 | 3300042655 | Bacteria | 1111 |
| 26 | Ga0466707_145546 | 3300042601 | Unclassified | 3273 |
| 27 | Ga0466719_021913 | 3300042606 | Bacteria | 1512 |
| 28 | Ga0466719_358280 | 3300042606 | Bacteria | 2052 |
| 29 | Ga0466719_402838 | 3300042606 | Bacteria | 2030 |
| 30 | Ga0466732_433286 | 3300042656 | Bacteria | 1156 |
| 31 | Ga0466733_158495 | 3300042659 | Bacteria | 1078 |
| 32 | Ga0466699_276973 | 3300042597 | Unclassified | 1071 |
| 33 | Ga0466699_367312 | 3300042597 | Bacteria | 1341 |
| 34 | Ga0466711_129068 | 3300042615 | Bacteria | 1095 |
| 35 | Ga0466711_297742 | 3300042615 | Bacteria | 3224 |
| 36 | Ga0466718_037893 | 3300042617 | Unclassified | 1594 |
| 37 | Ga0466726_215816 | 3300042619 | Bacteria | 1525 |
| 38 | FAAS_10202316 | 3300001880 | Bacteria | 510 |
| 39 | JGI24698J34947_10328967 | 3300002449 | Unclassified | 541 |
| 40 | Ga0466713_066117 | 3300042602 | Bacteria | 1123 |
| 41 | Ga0466705_013865 | 3300042612 | Bacteria | 2275 |
| 42 | Ga0456237_0033611 | 3300041968 | Bacteria | 684 |
| 43 | Ga0456237_0035758 | 3300041968 | Unclassified | 660 |
| 44 | Ga0123356_10049734 | 3300010049 | Bacteria | 3902 |
| 45 | Ga0466712_237069 | 3300042614 | Bacteria | 5188 |
| 46 | JGI24698J34947_10018424 | 3300002449 | Bacteria | 3772 |
| 47 | JGI24698J34947_10034508 | 3300002449 | Bacteria | 2647 |
| 48 | JGI24698J34947_10103887 | 3300002449 | Bacteria | 1270 |
| 49 | JGI24698J34947_10196831 | 3300002449 | Bacteria | 792 |
| 50 | JGI24697J35500_11166517 | 3300002507 | Bacteria | 1430 |
| 51 | Ga0074263_124516 | 3300005485 | Bacteria | 793 |
| 52 | Ga0466709_101265 | 3300042648 | Bacteria | 6563 |
| 53 | Ga0466709_292534 | 3300042648 | Bacteria | 5426 |
| 54 | Ga0466708_427595 | 3300042652 | Bacteria | 2394 |
| 55 | Ga0466707_218495 | 3300042601 | Bacteria | 2650 |
| 56 | Ga0466720_151878 | 3300042607 | Bacteria | 1589 |
| 57 | Ga0466690_194982 | 3300042590 | Bacteria | 2857 |
| 58 | Ga0466699_200873 | 3300042597 | Bacteria | 28554 |
| 59 | Ga0466699_242959 | 3300042597 | Bacteria | 1756 |
| 60 | Ga0123353_10709802 | 3300010167 | Unclassified | 1409 |
| 61 | Ga0466712_118759 | 3300042614 | Bacteria | 1437 |
| 62 | Ga0466718_065416 | 3300042617 | Bacteria | 1911 |
| 63 | JGI24698J34947_10003202 | 3300002449 | Bacteria | 8871 |
| 64 | JGI24698J34947_10150160 | 3300002449 | Bacteria | 969 |
| 65 | JGI24698J34947_10265838 | 3300002449 | Bacteria | 633 |
| 66 | Ga0072940_1177327 | 3300005200 | Bacteria | 1232 |
| 67 | Ga0466703_195295 | 3300042636 | Bacteria | 15480 |
| 68 | Ga0466704_028400 | 3300042643 | Bacteria | 1212 |
| 69 | Ga0466708_024751 | 3300042652 | Bacteria | 1064 |
| 70 | Ga0466708_190914 | 3300042652 | Bacteria | 2845 |
| 71 | Ga0466708_196845 | 3300042652 | Bacteria | 4348 |
| 72 | Ga0466727_053681 | 3300042655 | Bacteria | 1089 |
| 73 | Ga0466707_016308 | 3300042601 | Bacteria | 1212 |
| 74 | Ga0466707_177503 | 3300042601 | Bacteria | 1776 |
| 75 | Ga0264413_103060 | 3300024493 | Bacteria | 3695 |
| 76 | Ga0466699_119950 | 3300042597 | Bacteria | 1086 |
| 77 | Ga0123355_10103080 | 3300009826 | Bacteria | 4486 |
| 78 | Ga0466712_134066 | 3300042614 | Bacteria | 12272 |
| 79 | Ga0466712_224990 | 3300042614 | Bacteria | 6966 |
| 80 | Ga0466711_022029 | 3300042615 | Bacteria | 1355 |
| 81 | AustNasuHG_c1059765 | 3300000089 | Bacteria | 745 |
| 82 | FAAS_10327466 | 3300001880 | Unclassified | 500 |
| 83 | JGI24698J34947_10037269 | 3300002449 | Bacteria | 2527 |
| 84 | Ga0466714_137390 | 3300042603 | Bacteria | 1157 |
| 85 | Ga0466719_269076 | 3300042606 | Bacteria | 1871 |
| 86 | Ga0466719_504005 | 3300042606 | Bacteria | 2006 |
| 87 | Ga0466705_107961 | 3300042612 | Bacteria | 4687 |
| 88 | Ga0466690_080966 | 3300042590 | Unclassified | 1594 |
| 89 | Ga0466699_052879 | 3300042597 | Bacteria | 1816 |
| 90 | Ga0466699_291969 | 3300042597 | Unclassified | 1180 |
| 91 | Ga0466699_375764 | 3300042597 | Bacteria | 3160 |
| 92 | Ga0123356_10011276 | 3300010049 | Bacteria | 8721 |
| 93 | Ga0123356_12795221 | 3300010049 | Unclassified | 611 |
| 94 | Ga0466729_124005 | 3300042621 | Bacteria | 4040 |
| 95 | Ga0466704_381438 | 3300042643 | Bacteria | 1009 |
| 96 | Ga0466716_058635 | 3300042605 | Bacteria | 1650 |
| 97 | Ga0466720_073094 | 3300042607 | Bacteria | 8063 |
| 98 | Ga0466705_230737 | 3300042612 | Bacteria | 3003 |
| 99 | Ga0264413_112205 | 3300024493 | Unclassified | 3752 |
| 100 | Ga0466712_031504 | 3300042614 | Bacteria | 23103 |
| 101 | Ga0466726_096168 | 3300042619 | Bacteria | 1156 |
| 102 | Ga0466726_181626 | 3300042619 | Bacteria | 8344 |
| 103 | JGI24698J34947_10030106 | 3300002449 | Bacteria | 2864 |
| 104 | Ga0466735_219744 | 3300042624 | Bacteria | 1011 |
| 105 | Ga0466709_117200 | 3300042648 | Bacteria | 2297 |
| 106 | Ga0466708_084306 | 3300042652 | Bacteria | 5480 |
| 107 | Ga0466707_010956 | 3300042601 | Bacteria | 1364 |
| 108 | Ga0466707_057906 | 3300042601 | Bacteria | 3241 |
| 109 | Ga0466713_086383 | 3300042602 | Bacteria | 3668 |
| 110 | Ga0466719_036905 | 3300042606 | Bacteria | 3049 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 2 | 99 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.