Protein Family IF09370
Metagenome
Isolate
141
Members
46
Samples
136
Scaffolds
256.28
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_122710|Ga0466704_122710_1400_2290
- Length
- 282 aa
- Sequence
- LQINNQKNYLSIIKLNKNTSFMETKEKTVSNKNLSKKSRGISAFVVIIVALVLAVSFFQFVLGADKNFDGGVNTAASHPINLLGTMYKGGFVVPIILTLLLTVVILSVERAFALGKAKGKGNLIQFVAVVKSHMKKGDFASAEACCTKQKGSVAAIVDAGLKKYKEMETQSLPKESKIEEIKAELEEATALELPSMQQNLPIIATLGMIKSFQALGQAGSVDSVALSVGISEALVNTACGIATGALAIISYSYFSGKIDNMTYAIDEMGFALTQTYAETHNS
Sample Types
Isolate
3.5%
Metagenome
96.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.8%
Kalotermitidae
30.4%
Unclassified
15.2%
Termopsidae
6.5%
Rhinotermitidae
6.5%
Blattidae
2.2%
Hodotermitidae
2.2%
Passalidae
2.2%
Taxonomy
Archaea
1
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 8 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 11 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_169012 | 3300042611 | Unclassified | 1154 |
| 2 | Ga0466733_175458 | 3300042659 | Bacteria | 1179 |
| 3 | Ga0466692_104877 | 3300042591 | Bacteria | 8727 |
| 4 | Ga0466691_146027 | 3300042593 | Bacteria | 15489 |
| 5 | Ga0466696_393166 | 3300042596 | Bacteria | 1324 |
| 6 | Ga0466701_094770 | 3300042598 | Bacteria | 17462 |
| 7 | Ga0466700_026256 | 3300042600 | Bacteria | 21450 |
| 8 | Ga0466707_144952 | 3300042601 | Bacteria | 11420 |
| 9 | Ga0466719_305222 | 3300042606 | Bacteria | 4154 |
| 10 | Ga0466722_216998 | 3300042609 | Bacteria | 4897 |
| 11 | Ga0466735_186187 | 3300042624 | Bacteria | 5095 |
| 12 | IMNBL1DRAFT_c0003670 | 3300000062 | Bacteria | 9676 |
| 13 | JGI24699J35502_11134039 | 3300002509 | Bacteria | 26006 |
| 14 | Ga0123357_10000601 | 3300009784 | Bacteria | 35612 |
| 15 | Ga0123357_10002054 | 3300009784 | Bacteria | 22084 |
| 16 | Ga0123354_10000020 | 3300010882 | Bacteria | 127737 |
| 17 | Ga0466705_351769 | 3300042612 | Bacteria | 8631 |
| 18 | Ga0466690_075235 | 3300042590 | Bacteria | 10422 |
| 19 | Ga0466691_209732 | 3300042593 | Bacteria | 8726 |
| 20 | Ga0466711_242490 | 3300042615 | Bacteria | 19433 |
| 21 | Ga0466723_146235 | 3300042618 | Bacteria | 16058 |
| 22 | Ga0466726_244161 | 3300042619 | Bacteria | 2064 |
| 23 | Ga0466729_115703 | 3300042621 | Bacteria | 5020 |
| 24 | Ga0466706_284757 | 3300042599 | Bacteria | 1400 |
| 25 | Ga0466713_105697 | 3300042602 | Bacteria | 1295 |
| 26 | Ga0466716_141084 | 3300042605 | Unclassified | 12459 |
| 27 | Ga0466719_122540 | 3300042606 | Bacteria | 9119 |
| 28 | Ga0466735_145451 | 3300042624 | Bacteria | 2949 |
| 29 | Ga0466735_234355 | 3300042624 | Bacteria | 2299 |
| 30 | Ga0466704_122710 | 3300042643 | Bacteria | 12415 |
| 31 | JGI24705J35276_12074242 | 3300002504 | Bacteria | 960 |
| 32 | JGI24699J35502_11133687 | 3300002509 | Bacteria | 13530 |
| 33 | Ga0123357_10019263 | 3300009784 | Bacteria | 9089 |
| 34 | Ga0466692_082310 | 3300042591 | Bacteria | 17927 |
| 35 | Ga0466691_216055 | 3300042593 | Unclassified | 1415 |
| 36 | Ga0466694_013846 | 3300042594 | Bacteria | 2853 |
| 37 | Ga0466715_156320 | 3300042616 | Bacteria | 9972 |
| 38 | Ga0466723_251298 | 3300042618 | Bacteria | 10781 |
| 39 | Ga0466728_161570 | 3300042620 | Bacteria | 16747 |
| 40 | Ga0466700_184271 | 3300042600 | Bacteria | 14355 |
| 41 | Ga0466707_008939 | 3300042601 | Bacteria | 6269 |
| 42 | Ga0466707_062128 | 3300042601 | Bacteria | 19135 |
| 43 | Ga0466707_143153 | 3300042601 | Bacteria | 1999 |
| 44 | Ga0466713_072155 | 3300042602 | Bacteria | 7221 |
| 45 | Ga0466719_164345 | 3300042606 | Bacteria | 6286 |
| 46 | Ga0466722_116341 | 3300042609 | Bacteria | 3810 |
| 47 | Ga0466729_212978 | 3300042621 | Bacteria | 5499 |
| 48 | Ga0466735_202206 | 3300042624 | Bacteria | 1681 |
| 49 | Ga0466730_042453 | 3300042625 | Bacteria | 1353 |
| 50 | Ga0466703_315012 | 3300042636 | Bacteria | 4143 |
| 51 | Ga0466704_516628 | 3300042643 | Bacteria | 3047 |
| 52 | Ga0466709_061637 | 3300042648 | Bacteria | 61213 |
| 53 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 54 | Ga0123353_10884063 | 3300010167 | Bacteria | 1219 |
| 55 | Ga0123354_10000201 | 3300010882 | Bacteria | 51540 |
| 56 | Ga0123354_10012939 | 3300010882 | Bacteria | 12923 |
| 57 | Ga0466656_363660 | 3300042550 | Bacteria | 3719 |
| 58 | Ga0466690_002563 | 3300042590 | Bacteria | 35514 |
| 59 | Ga0466692_032473 | 3300042591 | Bacteria | 22846 |
| 60 | Ga0466701_070186 | 3300042598 | Bacteria | 3501 |
| 61 | Ga0466700_493204 | 3300042600 | Bacteria | 1378 |
| 62 | Ga0466722_236977 | 3300042609 | Bacteria | 5840 |
| 63 | Ga0466698_364340 | 3300042610 | Bacteria | 1872 |
| 64 | Ga0466703_064417 | 3300042636 | Bacteria | 1272 |
| 65 | Ga0466703_358211 | 3300042636 | Bacteria | 2195 |
| 66 | Ga0466703_412586 | 3300042636 | Bacteria | 2372 |
| 67 | Ga0123354_10014971 | 3300010882 | Bacteria | 12087 |
| 68 | Ga0123354_10226484 | 3300010882 | Bacteria | 1968 |
| 69 | Ga0466705_049385 | 3300042612 | Bacteria | 4196 |
| 70 | Ga0466690_103383 | 3300042590 | Bacteria | 29422 |
| 71 | Ga0466726_157671 | 3300042619 | Bacteria | 25979 |
| 72 | Ga0466726_275770 | 3300042619 | Bacteria | 15891 |
| 73 | Ga0466707_191673 | 3300042601 | Bacteria | 8925 |
| 74 | Ga0466713_000079 | 3300042602 | Bacteria | 9723 |
| 75 | Ga0466719_055774 | 3300042606 | Bacteria | 1838 |
| 76 | Ga0466719_335972 | 3300042606 | Bacteria | 2280 |
| 77 | Ga0466735_134874 | 3300042624 | Unclassified | 1211 |
| 78 | Ga0466703_187569 | 3300042636 | Bacteria | 2396 |
| 79 | Ga0466727_050930 | 3300042655 | Bacteria | 7104 |
| 80 | Ga0466727_280237 | 3300042655 | Unclassified | 2166 |
| 81 | Ga0068305_10018019 | 3300005083 | Unclassified | 1696 |
| 82 | Ga0123357_10027725 | 3300009784 | Bacteria | 7659 |
| 83 | Ga0123357_10143989 | 3300009784 | Unclassified | 2919 |
| 84 | Ga0123354_10471023 | 3300010882 | Bacteria | 1001 |
| 85 | Ga0466732_066321 | 3300042656 | Bacteria | 71309 |
| 86 | Ga0466692_035439 | 3300042591 | Bacteria | 14978 |
| 87 | Ga0466706_025055 | 3300042599 | Bacteria | 8003 |
| 88 | Ga0466713_082523 | 3300042602 | Bacteria | 11972 |
| 89 | Ga0466713_105442 | 3300042602 | Bacteria | 1877 |
| 90 | Ga0466713_106697 | 3300042602 | Bacteria | 23975 |
| 91 | Ga0466714_138494 | 3300042603 | Bacteria | 7038 |
| 92 | Ga0466714_148937 | 3300042603 | Bacteria | 12781 |
| 93 | Ga0466716_183914 | 3300042605 | Bacteria | 8825 |
| 94 | Ga0466735_111195 | 3300042624 | Bacteria | 4138 |
| 95 | Ga0466703_104988 | 3300042636 | Bacteria | 39552 |
| 96 | Ga0466703_353581 | 3300042636 | Bacteria | 4239 |
| 97 | Ga0466727_348535 | 3300042655 | Bacteria | 11423 |
| 98 | JGI24702J35022_10005057 | 3300002462 | Bacteria | 7770 |
| 99 | JGI24705J35276_12074192 | 3300002504 | Bacteria | 960 |
| 100 | JGI24699J35502_11134213 | 3300002509 | Bacteria | 63023 |
| 101 | Ga0123353_10630236 | 3300010167 | Bacteria | 1524 |
| 102 | Ga0466690_185285 | 3300042590 | Bacteria | 8561 |
| 103 | Ga0466696_055511 | 3300042596 | Bacteria | 18970 |
| 104 | Ga0466696_502391 | 3300042596 | Bacteria | 3344 |
| 105 | Ga0466715_270198 | 3300042616 | Bacteria | 10479 |
| 106 | Ga0466715_293034 | 3300042616 | Bacteria | 14484 |
| 107 | Ga0466726_055719 | 3300042619 | Bacteria | 11749 |
| 108 | Ga0466707_167533 | 3300042601 | Bacteria | 3665 |
| 109 | Ga0466713_028147 | 3300042602 | Bacteria | 10334 |
| 110 | Ga0466714_033452 | 3300042603 | Bacteria | 32073 |
| 111 | Ga0466735_024861 | 3300042624 | Bacteria | 2966 |
| 112 | Ga0466735_029475 | 3300042624 | Bacteria | 2418 |
| 113 | Ga0466735_188474 | 3300042624 | Bacteria | 1268 |
| 114 | Ga0466704_119167 | 3300042643 | Bacteria | 16466 |
| 115 | Ga0466709_370050 | 3300042648 | Bacteria | 9741 |
| 116 | Ga0466708_028462 | 3300042652 | Bacteria | 25947 |
| 117 | Ga0466708_058588 | 3300042652 | Bacteria | 9868 |
| 118 | Ga0123354_10002580 | 3300010882 | Bacteria | 24135 |
| 119 | Ga0466697_140789 | 3300042611 | Bacteria | 2371 |
| 120 | Ga0466692_182457 | 3300042591 | Bacteria | 1223 |
| 121 | Ga0466711_140239 | 3300042615 | Bacteria | 10795 |
| 122 | Ga0466715_095476 | 3300042616 | Bacteria | 15840 |
| 123 | Ga0466707_122611 | 3300042601 | Bacteria | 1652 |
| 124 | Ga0466707_224426 | 3300042601 | Bacteria | 9289 |
| 125 | Ga0466707_242775 | 3300042601 | Bacteria | 11468 |
| 126 | Ga0466713_033394 | 3300042602 | Bacteria | 24369 |
| 127 | Ga0466713_104547 | 3300042602 | Bacteria | 10003 |
| 128 | Ga0466719_416939 | 3300042606 | Bacteria | 6423 |
| 129 | Ga0466722_045111 | 3300042609 | Bacteria | 2942 |
| 130 | Ga0466722_241244 | 3300042609 | Unclassified | 1749 |
| 131 | Ga0466735_044630 | 3300042624 | Bacteria | 3928 |
| 132 | Ga0466735_135792 | 3300042624 | Bacteria | 1208 |
| 133 | Ga0466703_040225 | 3300042636 | Bacteria | 28005 |
| 134 | Ga0466704_038381 | 3300042643 | Bacteria | 7986 |
| 135 | Ga0466704_507270 | 3300042643 | Bacteria | 10828 |
| 136 | Ga0123354_10205529 | 3300010882 | Archaea | 2148 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01618 | MotA_ExbB | MotA/TolQ/ExbB proton channel family | 154 | 266 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.