Protein Family IF09366
Metagenome
Isolate
203
Members
53
Samples
194
Scaffolds
280.82
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_110295|Ga0466704_110295_1103_2113
- Length
- 336 aa
- Sequence
- MLKLRSGLSPPRLHGRWEVCAKRKLRKPLSRRGNGSSPFLNFALYVILPGRGSHRQMNENWNIIIEPKRKLLDLQIRDIIRYRDLIFLFVQRDFVVQYKQTILGPLWYVINPLFSTVMYTFVFGNLANIGTDGIPFLLFYYSGTMLWTFFTGCFTNASEIFITNANIFGKVYFPRLTVPISNVFSNSIKALIQFALLMSFFIYYLINRASLSPSWYAFAFPALLIWIAALGTGMGMIISALTTKYRDLKQLVTFALGLAMYITPVVYPLSQIPGRFGWLVFVNPLSTPIELFRLWFFGAGSVTTPMILTSLAMTAAFLLLGLILFNQNERNFVDVV
Sample Types
Isolate
4.4%
Metagenome
95.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.2%
Kalotermitidae
25.5%
Unclassified
21.6%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Passalidae
2.0%
Taxonomy
Archaea
1
Bacteria
199
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 8 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 9 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 14 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 15 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 16 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 17 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 47 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 53 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_056966 | 3300042612 | Bacteria | 1475 |
| 2 | Ga0466732_280874 | 3300042656 | Bacteria | 2500 |
| 3 | Ga0466732_295544 | 3300042656 | Bacteria | 4738 |
| 4 | Ga0466712_041086 | 3300042614 | Bacteria | 62732 |
| 5 | Ga0466712_154629 | 3300042614 | Bacteria | 40642 |
| 6 | Ga0466726_060061 | 3300042619 | Bacteria | 1852 |
| 7 | Ga0466729_050490 | 3300042621 | Bacteria | 3885 |
| 8 | Ga0123353_10816845 | 3300010167 | Bacteria | 1284 |
| 9 | Ga0466707_187733 | 3300042601 | Bacteria | 3898 |
| 10 | Ga0466713_110798 | 3300042602 | Bacteria | 1253 |
| 11 | Ga0466716_259629 | 3300042605 | Bacteria | 2839 |
| 12 | Ga0466722_023448 | 3300042609 | Bacteria | 22084 |
| 13 | Ga0466692_096393 | 3300042591 | Bacteria | 1729 |
| 14 | Ga0466704_081910 | 3300042643 | Bacteria | 5266 |
| 15 | Ga0466704_293302 | 3300042643 | Bacteria | 13326 |
| 16 | Ga0466704_293873 | 3300042643 | Bacteria | 3130 |
| 17 | Ga0466704_398777 | 3300042643 | Bacteria | 22916 |
| 18 | Ga0466709_020463 | 3300042648 | Bacteria | 3775 |
| 19 | JGI24698J34947_10076428 | 3300002449 | Bacteria | 1588 |
| 20 | Ga0072941_1085276 | 3300005201 | Bacteria | 3559 |
| 21 | Ga0466697_102561 | 3300042611 | Bacteria | 1124 |
| 22 | Ga0466732_270943 | 3300042656 | Bacteria | 4078 |
| 23 | Ga0466715_334080 | 3300042616 | Bacteria | 1981 |
| 24 | Ga0466719_473072 | 3300042606 | Bacteria | 58828 |
| 25 | Ga0466720_012895 | 3300042607 | Bacteria | 75127 |
| 26 | Ga0466720_131560 | 3300042607 | Bacteria | 48024 |
| 27 | Ga0466720_185900 | 3300042607 | Bacteria | 9850 |
| 28 | Ga0264413_137299 | 3300024493 | Bacteria | 5296 |
| 29 | Ga0466692_082787 | 3300042591 | Bacteria | 11257 |
| 30 | Ga0466692_184475 | 3300042591 | Bacteria | 2394 |
| 31 | Ga0466691_097761 | 3300042593 | Bacteria | 7504 |
| 32 | Ga0466691_105856 | 3300042593 | Bacteria | 8211 |
| 33 | Ga0466699_007427 | 3300042597 | Bacteria | 23813 |
| 34 | Ga0466699_187061 | 3300042597 | Bacteria | 5272 |
| 35 | Ga0466699_219965 | 3300042597 | Bacteria | 10807 |
| 36 | Ga0466735_196684 | 3300042624 | Bacteria | 1794 |
| 37 | Ga0466704_543240 | 3300042643 | Bacteria | 6769 |
| 38 | Ga0466704_547934 | 3300042643 | Bacteria | 3088 |
| 39 | Ga0466708_343355 | 3300042652 | Bacteria | 3126 |
| 40 | IMNBL1DRAFT_c0026171 | 3300000062 | Bacteria | 2222 |
| 41 | Ga0072940_1022040 | 3300005200 | Bacteria | 2039 |
| 42 | Ga0072941_1014903 | 3300005201 | Bacteria | 2269 |
| 43 | Ga0466715_374177 | 3300042616 | Bacteria | 8365 |
| 44 | Ga0123355_10000659 | 3300009826 | Bacteria | 46817 |
| 45 | Ga0466707_175642 | 3300042601 | Bacteria | 1645 |
| 46 | Ga0466720_046917 | 3300042607 | Bacteria | 61630 |
| 47 | Ga0466720_105750 | 3300042607 | Bacteria | 1936 |
| 48 | Ga0466720_108024 | 3300042607 | Bacteria | 60869 |
| 49 | Ga0466722_002841 | 3300042609 | Bacteria | 8378 |
| 50 | Ga0466722_137819 | 3300042609 | Bacteria | 30114 |
| 51 | Ga0466690_031458 | 3300042590 | Bacteria | 1328 |
| 52 | Ga0466692_172189 | 3300042591 | Bacteria | 6746 |
| 53 | Ga0466694_360805 | 3300042594 | Bacteria | 3370 |
| 54 | Ga0466696_037451 | 3300042596 | Bacteria | 1149 |
| 55 | Ga0466696_499919 | 3300042596 | Bacteria | 2673 |
| 56 | Ga0466699_018975 | 3300042597 | Bacteria | 8535 |
| 57 | Ga0466731_245932 | 3300042622 | Bacteria | 1397 |
| 58 | Ga0466704_074773 | 3300042643 | Bacteria | 34926 |
| 59 | Ga0466704_110351 | 3300042643 | Bacteria | 3584 |
| 60 | AustNasuHG_c1001151 | 3300000089 | Bacteria | 9491 |
| 61 | AustNasuHG_c1001780 | 3300000089 | Bacteria | 7804 |
| 62 | JGI24695J34938_10093506 | 3300002450 | Bacteria | 1232 |
| 63 | Ga0072940_1000948 | 3300005200 | Bacteria | 22507 |
| 64 | Ga0072941_1023804 | 3300005201 | Unclassified | 10962 |
| 65 | Ga0072941_1048633 | 3300005201 | Bacteria | 5546 |
| 66 | Ga0072941_1101477 | 3300005201 | Unclassified | 2423 |
| 67 | Ga0466712_259151 | 3300042614 | Bacteria | 11135 |
| 68 | Ga0466718_006058 | 3300042617 | Bacteria | 2156 |
| 69 | Ga0466726_299720 | 3300042619 | Bacteria | 2076 |
| 70 | Ga0466726_419394 | 3300042619 | Bacteria | 2110 |
| 71 | Ga0466707_312745 | 3300042601 | Bacteria | 1841 |
| 72 | Ga0466716_485331 | 3300042605 | Bacteria | 1521 |
| 73 | Ga0466720_076663 | 3300042607 | Bacteria | 2989 |
| 74 | Ga0264413_103607 | 3300024493 | Bacteria | 10123 |
| 75 | Ga0264413_104713 | 3300024493 | Bacteria | 35389 |
| 76 | Ga0264413_125104 | 3300024493 | Bacteria | 6411 |
| 77 | Ga0466656_351002 | 3300042550 | Bacteria | 3797 |
| 78 | Ga0466692_110335 | 3300042591 | Bacteria | 12834 |
| 79 | Ga0466699_111287 | 3300042597 | Bacteria | 7045 |
| 80 | Ga0466699_320928 | 3300042597 | Bacteria | 3749 |
| 81 | Ga0466735_063117 | 3300042624 | Bacteria | 4308 |
| 82 | Ga0466735_111436 | 3300042624 | Bacteria | 17607 |
| 83 | Ga0466702_326945 | 3300042635 | Bacteria | 2066 |
| 84 | Ga0466708_063262 | 3300042652 | Bacteria | 4188 |
| 85 | AustNasuHG_c1015024 | 3300000089 | Bacteria | 2620 |
| 86 | JGI24695J34938_10000989 | 3300002450 | Bacteria | 25804 |
| 87 | Ga0072941_1169187 | 3300005201 | Bacteria | 977 |
| 88 | Ga0466712_112275 | 3300042614 | Bacteria | 22556 |
| 89 | Ga0466712_189837 | 3300042614 | Bacteria | 23751 |
| 90 | Ga0466711_231507 | 3300042615 | Bacteria | 3294 |
| 91 | Ga0466711_392692 | 3300042615 | Bacteria | 4008 |
| 92 | Ga0466715_142776 | 3300042616 | Bacteria | 6788 |
| 93 | Ga0466718_046298 | 3300042617 | Bacteria | 49319 |
| 94 | Ga0466726_164213 | 3300042619 | Bacteria | 10325 |
| 95 | Ga0466726_411589 | 3300042619 | Bacteria | 1260 |
| 96 | Ga0123356_10045040 | 3300010049 | Bacteria | 4105 |
| 97 | Ga0123356_10243731 | 3300010049 | Bacteria | 1870 |
| 98 | Ga0466720_013503 | 3300042607 | Bacteria | 19037 |
| 99 | Ga0466720_139881 | 3300042607 | Bacteria | 12965 |
| 100 | Ga0264413_105993 | 3300024493 | Bacteria | 16145 |
| 101 | Ga0466690_102306 | 3300042590 | Bacteria | 3089 |
| 102 | Ga0466696_036611 | 3300042596 | Bacteria | 1478 |
| 103 | Ga0466699_059019 | 3300042597 | Archaea | 16041 |
| 104 | Ga0466699_088613 | 3300042597 | Bacteria | 91931 |
| 105 | Ga0466699_186064 | 3300042597 | Unclassified | 12998 |
| 106 | Ga0466699_261364 | 3300042597 | Bacteria | 2768 |
| 107 | Ga0466699_270029 | 3300042597 | Bacteria | 1375 |
| 108 | Ga0466699_284466 | 3300042597 | Bacteria | 5335 |
| 109 | Ga0466703_005280 | 3300042636 | Bacteria | 11563 |
| 110 | Ga0466703_250285 | 3300042636 | Bacteria | 4635 |
| 111 | Ga0466727_187663 | 3300042655 | Bacteria | 1406 |
| 112 | AustNasuHG_c1002650 | 3300000089 | Bacteria | 6460 |
| 113 | AustNasuHG_c1003909 | 3300000089 | Bacteria | 5366 |
| 114 | AustNasuHG_c1036359 | 3300000089 | Bacteria | 1279 |
| 115 | Ga0466732_380507 | 3300042656 | Bacteria | 3543 |
| 116 | Ga0466705_461230 | 3300042612 | Bacteria | 4772 |
| 117 | Ga0466712_014740 | 3300042614 | Bacteria | 1669 |
| 118 | Ga0466715_083104 | 3300042616 | Bacteria | 3123 |
| 119 | Ga0466715_224063 | 3300042616 | Bacteria | 4620 |
| 120 | Ga0466718_033853 | 3300042617 | Bacteria | 13524 |
| 121 | Ga0466718_117228 | 3300042617 | Bacteria | 6709 |
| 122 | Ga0466718_160911 | 3300042617 | Bacteria | 8060 |
| 123 | Ga0466723_082453 | 3300042618 | Bacteria | 72592 |
| 124 | Ga0466719_412865 | 3300042606 | Bacteria | 31020 |
| 125 | Ga0466720_034670 | 3300042607 | Bacteria | 16588 |
| 126 | Ga0466720_133222 | 3300042607 | Bacteria | 3121 |
| 127 | Ga0415639_053094 | 3300038395 | Bacteria | 8007 |
| 128 | Ga0466692_002215 | 3300042591 | Bacteria | 38338 |
| 129 | Ga0466691_117958 | 3300042593 | Bacteria | 28278 |
| 130 | Ga0466699_042694 | 3300042597 | Bacteria | 13384 |
| 131 | Ga0466699_120425 | 3300042597 | Bacteria | 25749 |
| 132 | Ga0466699_247572 | 3300042597 | Bacteria | 7070 |
| 133 | AustNasuHG_c1000422 | 3300000089 | Bacteria | 14716 |
| 134 | JGI24698J34947_10000837 | 3300002449 | Bacteria | 15430 |
| 135 | JGI24698J34947_10006069 | 3300002449 | Bacteria | 6632 |
| 136 | Ga0072940_1117510 | 3300005200 | Bacteria | 1584 |
| 137 | Ga0466732_112176 | 3300042656 | Bacteria | 19030 |
| 138 | Ga0466712_036330 | 3300042614 | Bacteria | 18507 |
| 139 | Ga0466712_147179 | 3300042614 | Bacteria | 3080 |
| 140 | Ga0466711_426247 | 3300042615 | Bacteria | 1909 |
| 141 | Ga0466715_156433 | 3300042616 | Bacteria | 7706 |
| 142 | Ga0466718_013791 | 3300042617 | Bacteria | 36967 |
| 143 | Ga0466718_029744 | 3300042617 | Bacteria | 17742 |
| 144 | Ga0466723_015302 | 3300042618 | Bacteria | 1435 |
| 145 | Ga0466723_157044 | 3300042618 | Bacteria | 10919 |
| 146 | Ga0466726_412613 | 3300042619 | Bacteria | 2529 |
| 147 | Ga0466726_430238 | 3300042619 | Bacteria | 1291 |
| 148 | Ga0123356_10000833 | 3300010049 | Bacteria | 34368 |
| 149 | Ga0466719_249016 | 3300042606 | Bacteria | 2095 |
| 150 | Ga0466719_508191 | 3300042606 | Bacteria | 9037 |
| 151 | Ga0466722_054824 | 3300042609 | Bacteria | 10859 |
| 152 | Ga0264413_103609 | 3300024493 | Bacteria | 2421 |
| 153 | Ga0264413_104259 | 3300024493 | Bacteria | 24164 |
| 154 | Ga0466692_013737 | 3300042591 | Bacteria | 2140 |
| 155 | Ga0466691_167701 | 3300042593 | Bacteria | 1990 |
| 156 | Ga0466694_209526 | 3300042594 | Bacteria | 2332 |
| 157 | Ga0466699_027774 | 3300042597 | Bacteria | 28809 |
| 158 | Ga0466699_200327 | 3300042597 | Bacteria | 6297 |
| 159 | Ga0466699_227539 | 3300042597 | Bacteria | 1004 |
| 160 | Ga0466699_438035 | 3300042597 | Bacteria | 2394 |
| 161 | Ga0466704_110295 | 3300042643 | Bacteria | 8491 |
| 162 | AustNasuHG_c1001293 | 3300000089 | Bacteria | 8987 |
| 163 | JGI24695J34938_10001273 | 3300002450 | Bacteria | 22105 |
| 164 | JGI24695J34938_10001457 | 3300002450 | Bacteria | 20019 |
| 165 | Ga0072940_1089973 | 3300005200 | Bacteria | 5381 |
| 166 | Ga0072941_1071072 | 3300005201 | Bacteria | 2921 |
| 167 | Ga0466705_018346 | 3300042612 | Bacteria | 13177 |
| 168 | Ga0466732_321648 | 3300042656 | Bacteria | 18449 |
| 169 | Ga0466732_324392 | 3300042656 | Bacteria | 21191 |
| 170 | Ga0466711_248653 | 3300042615 | Bacteria | 11071 |
| 171 | Ga0466711_296871 | 3300042615 | Bacteria | 3917 |
| 172 | Ga0466715_431253 | 3300042616 | Bacteria | 16440 |
| 173 | Ga0466718_159625 | 3300042617 | Bacteria | 1092 |
| 174 | Ga0466723_079137 | 3300042618 | Bacteria | 2374 |
| 175 | Ga0123353_10424588 | 3300010167 | Bacteria | 1968 |
| 176 | Ga0466720_145662 | 3300042607 | Bacteria | 157622 |
| 177 | Ga0466720_208368 | 3300042607 | Bacteria | 9543 |
| 178 | Ga0466722_119833 | 3300042609 | Bacteria | 3875 |
| 179 | Ga0466698_051612 | 3300042610 | Bacteria | 1807 |
| 180 | Ga0264413_103608 | 3300024493 | Bacteria | 12718 |
| 181 | Ga0264413_107963 | 3300024493 | Bacteria | 7153 |
| 182 | Ga0264413_133116 | 3300024493 | Bacteria | 6927 |
| 183 | Ga0466696_350222 | 3300042596 | Bacteria | 1107 |
| 184 | Ga0466699_110952 | 3300042597 | Bacteria | 2558 |
| 185 | Ga0466699_195069 | 3300042597 | Bacteria | 2954 |
| 186 | Ga0466699_271015 | 3300042597 | Bacteria | 6485 |
| 187 | Ga0466735_101535 | 3300042624 | Bacteria | 1131 |
| 188 | Ga0466702_034624 | 3300042635 | Bacteria | 24227 |
| 189 | Ga0466704_255505 | 3300042643 | Bacteria | 1904 |
| 190 | JGI24698J34947_10000210 | 3300002449 | Bacteria | 23899 |
| 191 | JGI24695J34938_10031656 | 3300002450 | Bacteria | 2451 |
| 192 | JGI24705J35276_12206305 | 3300002504 | Bacteria | 1718 |
| 193 | Ga0072940_1013176 | 3300005200 | Bacteria | 15881 |
| 194 | Ga0072941_1169186 | 3300005201 | Bacteria | 1672 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01061 | ABC2_membrane | ABC-2 type transporter | 86 | 295 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.