Protein Family IF09363
Metagenome
Metatranscriptome
Isolate
251
Members
55
Samples
244
Scaffolds
258.66
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_107546|Ga0466704_107546_2137_3069
- Length
- 310 aa
- Sequence
- MKIAVTGKGGVGKTTLAAALARLYAADGKSVLAVDADPDANLGLALGFTAEEISRITPIAEMADLIAERTGTGKNSYGSFFKINPRVDDIPGRFAVDKDGVKLLVMGTVETGGGGCVCPEHVMLKRVISHLVIDSEDVVIMDMEAGIEHLGRGTAGMVDRFIVVVEPGARSIQTYERIKSLAADLGVTRVSVVGNKITDESDKAFISERAPEADILGYISYSTDVMKADKAGVSPLTAGSGFLEETLIKDMSPDSPMDLVHIAGKKRRGTGGITRLFPEDRRQIGGECARHSFNQCFLKEVETIKGRIGA
Sample Types
Isolate
2.8%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
1.2%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.5%
Kalotermitidae
26.9%
Unclassified
19.2%
Rhinotermitidae
7.7%
Termopsidae
7.7%
Hodotermitidae
1.9%
Taxonomy
Archaea
3
Bacteria
225
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 25 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 33 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300021221 | Termite gut microbial communities from nest - French Guiana - 18a-5 mRNA SA | Metatranscriptome | Termitidae |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 40 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 48 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 49 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_343552 | 3300042612 | Bacteria | 8895 |
| 2 | Ga0466707_025052 | 3300042601 | Bacteria | 18415 |
| 3 | Ga0466707_036422 | 3300042601 | Bacteria | 1940 |
| 4 | Ga0466707_263736 | 3300042601 | Bacteria | 90817 |
| 5 | Ga0466719_067776 | 3300042606 | Bacteria | 17099 |
| 6 | Ga0466719_185682 | 3300042606 | Bacteria | 1055 |
| 7 | Ga0466719_547918 | 3300042606 | Bacteria | 8680 |
| 8 | Ga0466721_166795 | 3300042608 | Bacteria | 33336 |
| 9 | Ga0466722_128690 | 3300042609 | Unclassified | 8674 |
| 10 | Ga0123356_10173221 | 3300010049 | Bacteria | 2171 |
| 11 | Ga0123353_10027314 | 3300010167 | Bacteria | 8745 |
| 12 | Ga0456237_0005797 | 3300041968 | Bacteria | 1952 |
| 13 | Ga0466690_060087 | 3300042590 | Bacteria | 9012 |
| 14 | Ga0466692_001840 | 3300042591 | Bacteria | 59554 |
| 15 | Ga0466729_302168 | 3300042621 | Bacteria | 1843 |
| 16 | Ga0466727_090883 | 3300042655 | Bacteria | 5849 |
| 17 | Ga0466705_484913 | 3300042612 | Bacteria | 6529 |
| 18 | Ga0466705_505453 | 3300042612 | Bacteria | 1775 |
| 19 | Ga0466711_143067 | 3300042615 | Bacteria | 38768 |
| 20 | Ga0466715_094285 | 3300042616 | Bacteria | 4748 |
| 21 | Ga0466723_090247 | 3300042618 | Bacteria | 25495 |
| 22 | Ga0466723_153446 | 3300042618 | Bacteria | 1151 |
| 23 | Ga0466726_027324 | 3300042619 | Bacteria | 3551 |
| 24 | Ga0466728_475051 | 3300042620 | Bacteria | 5617 |
| 25 | Ga0466705_036392 | 3300042612 | Bacteria | 23320 |
| 26 | Ga0466705_331486 | 3300042612 | Bacteria | 57655 |
| 27 | Ga0466706_097023 | 3300042599 | Bacteria | 1231 |
| 28 | Ga0466707_257730 | 3300042601 | Unclassified | 1692 |
| 29 | Ga0466719_088309 | 3300042606 | Bacteria | 60348 |
| 30 | Ga0466722_034222 | 3300042609 | Bacteria | 13072 |
| 31 | Ga0466698_135781 | 3300042610 | Bacteria | 2960 |
| 32 | Ga0223677_1005896 | 3300021239 | Bacteria | 1162 |
| 33 | Ga0456237_0012365 | 3300041968 | Bacteria | 1235 |
| 34 | Ga0466690_156387 | 3300042590 | Bacteria | 3592 |
| 35 | Ga0466692_052284 | 3300042591 | Unclassified | 2743 |
| 36 | Ga0466694_305090 | 3300042594 | Bacteria | 3614 |
| 37 | Ga0466696_039982 | 3300042596 | Bacteria | 5221 |
| 38 | Ga0466696_060728 | 3300042596 | Bacteria | 2005 |
| 39 | Ga0466703_069324 | 3300042636 | Bacteria | 15430 |
| 40 | Ga0466703_089339 | 3300042636 | Bacteria | 42751 |
| 41 | Ga0466703_227904 | 3300042636 | Bacteria | 6872 |
| 42 | Ga0466704_177860 | 3300042643 | Bacteria | 1197 |
| 43 | Ga0466704_389477 | 3300042643 | Bacteria | 39316 |
| 44 | Ga0466704_580554 | 3300042643 | Unclassified | 3309 |
| 45 | Ga0466704_581899 | 3300042643 | Bacteria | 3493 |
| 46 | Ga0466709_407735 | 3300042648 | Bacteria | 2297 |
| 47 | Ga0466708_086897 | 3300042652 | Bacteria | 18459 |
| 48 | Ga0466708_166190 | 3300042652 | Bacteria | 10252 |
| 49 | Ga0466727_058834 | 3300042655 | Bacteria | 3914 |
| 50 | Ga0068302_10533344 | 3300005071 | Bacteria | 955 |
| 51 | Ga0068305_10180121 | 3300005083 | Bacteria | 3903 |
| 52 | Ga0072941_1060556 | 3300005201 | Bacteria | 5498 |
| 53 | Ga0466705_409984 | 3300042612 | Bacteria | 1068 |
| 54 | Ga0466711_474502 | 3300042615 | Unclassified | 2600 |
| 55 | Ga0466718_050755 | 3300042617 | Bacteria | 1185 |
| 56 | Ga0466723_190709 | 3300042618 | Bacteria | 8802 |
| 57 | Ga0466726_076377 | 3300042619 | Bacteria | 10215 |
| 58 | Ga0466726_232864 | 3300042619 | Bacteria | 10700 |
| 59 | Ga0466726_272458 | 3300042619 | Bacteria | 1681 |
| 60 | Ga0466726_328446 | 3300042619 | Bacteria | 8756 |
| 61 | Ga0466728_069077 | 3300042620 | Bacteria | 18715 |
| 62 | Ga0466728_186869 | 3300042620 | Bacteria | 1889 |
| 63 | Ga0466705_272379 | 3300042612 | Bacteria | 2077 |
| 64 | Ga0466700_262748 | 3300042600 | Bacteria | 1274 |
| 65 | Ga0466707_199463 | 3300042601 | Bacteria | 15995 |
| 66 | Ga0466707_354614 | 3300042601 | Unclassified | 1237 |
| 67 | Ga0466713_087915 | 3300042602 | Bacteria | 4720 |
| 68 | Ga0466713_144704 | 3300042602 | Bacteria | 19723 |
| 69 | Ga0466716_158507 | 3300042605 | Unclassified | 1423 |
| 70 | Ga0466720_062059 | 3300042607 | Unclassified | 1688 |
| 71 | Ga0466720_096562 | 3300042607 | Bacteria | 49019 |
| 72 | Ga0466722_078508 | 3300042609 | Bacteria | 7178 |
| 73 | Ga0466722_100675 | 3300042609 | Bacteria | 12542 |
| 74 | Ga0466698_039789 | 3300042610 | Bacteria | 3872 |
| 75 | Ga0123356_10077319 | 3300010049 | Bacteria | 3138 |
| 76 | Ga0264413_104440 | 3300024493 | Bacteria | 23879 |
| 77 | Ga0466690_002418 | 3300042590 | Bacteria | 8394 |
| 78 | Ga0466690_141972 | 3300042590 | Unclassified | 3055 |
| 79 | Ga0466696_199697 | 3300042596 | Bacteria | 3131 |
| 80 | Ga0466703_182367 | 3300042636 | Bacteria | 18732 |
| 81 | Ga0466703_219274 | 3300042636 | Bacteria | 23078 |
| 82 | Ga0466703_266022 | 3300042636 | Bacteria | 3436 |
| 83 | Ga0466727_138617 | 3300042655 | Archaea | 7159 |
| 84 | Ga0466727_207560 | 3300042655 | Bacteria | 1704 |
| 85 | Ga0466727_330104 | 3300042655 | Unclassified | 5339 |
| 86 | JGI24702J35022_10031245 | 3300002462 | Bacteria | 2855 |
| 87 | Ga0068302_10324189 | 3300005071 | Bacteria | 1339 |
| 88 | Ga0466712_029944 | 3300042614 | Unclassified | 1323 |
| 89 | Ga0466715_575183 | 3300042616 | Bacteria | 7873 |
| 90 | Ga0466723_069264 | 3300042618 | Bacteria | 9558 |
| 91 | Ga0466723_130490 | 3300042618 | Bacteria | 37311 |
| 92 | Ga0466723_257447 | 3300042618 | Bacteria | 9540 |
| 93 | Ga0466726_243173 | 3300042619 | Bacteria | 1256 |
| 94 | Ga0466705_009774 | 3300042612 | Bacteria | 5190 |
| 95 | Ga0466707_081943 | 3300042601 | Bacteria | 3378 |
| 96 | Ga0466716_136524 | 3300042605 | Bacteria | 4134 |
| 97 | Ga0466719_086308 | 3300042606 | Bacteria | 21064 |
| 98 | Ga0466719_098612 | 3300042606 | Unclassified | 1560 |
| 99 | Ga0466719_181826 | 3300042606 | Bacteria | 10021 |
| 100 | Ga0466719_244056 | 3300042606 | Bacteria | 12471 |
| 101 | Ga0466722_197174 | 3300042609 | Bacteria | 2211 |
| 102 | Ga0123356_10264261 | 3300010049 | Bacteria | 1807 |
| 103 | Ga0123356_10737082 | 3300010049 | Bacteria | 1155 |
| 104 | Ga0123353_10061166 | 3300010167 | Bacteria | 6039 |
| 105 | Ga0255786_1001313 | 3300022815 | Archaea | 4974 |
| 106 | Ga0264413_100476 | 3300024493 | Bacteria | 9439 |
| 107 | Ga0466690_095471 | 3300042590 | Bacteria | 57449 |
| 108 | Ga0466696_472594 | 3300042596 | Bacteria | 4127 |
| 109 | Ga0466699_292514 | 3300042597 | Bacteria | 9037 |
| 110 | Ga0466731_041761 | 3300042622 | Bacteria | 1560 |
| 111 | Ga0466735_156474 | 3300042624 | Bacteria | 1335 |
| 112 | Ga0466703_082646 | 3300042636 | Bacteria | 8243 |
| 113 | Ga0466703_271927 | 3300042636 | Bacteria | 9639 |
| 114 | Ga0466704_045136 | 3300042643 | Bacteria | 7864 |
| 115 | Ga0466704_080001 | 3300042643 | Bacteria | 33472 |
| 116 | Ga0466704_534850 | 3300042643 | Unclassified | 4008 |
| 117 | Ga0466727_098090 | 3300042655 | Bacteria | 1440 |
| 118 | Ga0466727_122528 | 3300042655 | Bacteria | 1567 |
| 119 | JGI24698J34947_10008546 | 3300002449 | Unclassified | 5620 |
| 120 | Ga0068302_10196122 | 3300005071 | Bacteria | 1377 |
| 121 | Ga0466711_101645 | 3300042615 | Bacteria | 1083 |
| 122 | Ga0466715_155635 | 3300042616 | Bacteria | 24139 |
| 123 | Ga0466715_283628 | 3300042616 | Bacteria | 14220 |
| 124 | Ga0466723_278876 | 3300042618 | Bacteria | 6216 |
| 125 | Ga0466726_044468 | 3300042619 | Bacteria | 7207 |
| 126 | Ga0466726_201672 | 3300042619 | Bacteria | 2140 |
| 127 | Ga0466705_021350 | 3300042612 | Bacteria | 7334 |
| 128 | Ga0466705_193565 | 3300042612 | Bacteria | 15617 |
| 129 | Ga0466705_205234 | 3300042612 | Bacteria | 13293 |
| 130 | Ga0466705_354513 | 3300042612 | Bacteria | 8075 |
| 131 | Ga0466727_350764 | 3300042655 | Bacteria | 1168 |
| 132 | Ga0466732_280310 | 3300042656 | Bacteria | 3045 |
| 133 | Ga0466700_164503 | 3300042600 | Bacteria | 1418 |
| 134 | Ga0466707_144418 | 3300042601 | Bacteria | 25741 |
| 135 | Ga0466713_075007 | 3300042602 | Bacteria | 11132 |
| 136 | Ga0466716_136741 | 3300042605 | Bacteria | 2469 |
| 137 | Ga0466720_016393 | 3300042607 | Bacteria | 1789 |
| 138 | Ga0466722_172874 | 3300042609 | Bacteria | 1013 |
| 139 | Ga0123356_10132378 | 3300010049 | Bacteria | 2445 |
| 140 | Ga0123356_10400449 | 3300010049 | Bacteria | 1510 |
| 141 | Ga0123353_10708014 | 3300010167 | Bacteria | 1411 |
| 142 | Ga0123354_10016901 | 3300010882 | Bacteria | 11426 |
| 143 | Ga0466692_195938 | 3300042591 | Bacteria | 19284 |
| 144 | Ga0466704_237376 | 3300042643 | Bacteria | 9329 |
| 145 | Ga0466709_320558 | 3300042648 | Bacteria | 20457 |
| 146 | Ga0466708_413450 | 3300042652 | Bacteria | 9559 |
| 147 | Ga0466727_261083 | 3300042655 | Unclassified | 1249 |
| 148 | Ga0466727_287710 | 3300042655 | Bacteria | 7177 |
| 149 | JGI24698J34947_10084866 | 3300002449 | Bacteria | 1473 |
| 150 | Ga0466705_393358 | 3300042612 | Bacteria | 2401 |
| 151 | Ga0466705_419498 | 3300042612 | Unclassified | 2013 |
| 152 | Ga0466705_453680 | 3300042612 | Bacteria | 60201 |
| 153 | Ga0466718_155608 | 3300042617 | Bacteria | 1025 |
| 154 | Ga0466723_239855 | 3300042618 | Bacteria | 9947 |
| 155 | Ga0466726_070091 | 3300042619 | Bacteria | 3367 |
| 156 | Ga0466726_107572 | 3300042619 | Bacteria | 7679 |
| 157 | Ga0466705_198455 | 3300042612 | Bacteria | 2267 |
| 158 | Ga0466705_243425 | 3300042612 | Bacteria | 3608 |
| 159 | Ga0466706_025309 | 3300042599 | Bacteria | 4630 |
| 160 | Ga0466713_122137 | 3300042602 | Bacteria | 1336 |
| 161 | Ga0466722_222206 | 3300042609 | Bacteria | 19291 |
| 162 | Ga0466722_258037 | 3300042609 | Bacteria | 5254 |
| 163 | Ga0223689_101113 | 3300021221 | Bacteria | 2034 |
| 164 | Ga0456237_0013754 | 3300041968 | Bacteria | 1159 |
| 165 | Ga0466692_094676 | 3300042591 | Unclassified | 2743 |
| 166 | Ga0466693_063587 | 3300042592 | Bacteria | 2151 |
| 167 | Ga0466696_049179 | 3300042596 | Bacteria | 2169 |
| 168 | Ga0466735_037455 | 3300042624 | Bacteria | 6263 |
| 169 | Ga0466735_086241 | 3300042624 | Archaea | 4265 |
| 170 | Ga0466703_076231 | 3300042636 | Bacteria | 23285 |
| 171 | Ga0466704_107546 | 3300042643 | Bacteria | 8371 |
| 172 | Ga0466704_239917 | 3300042643 | Bacteria | 52442 |
| 173 | Ga0466704_288953 | 3300042643 | Bacteria | 7097 |
| 174 | Ga0466704_386648 | 3300042643 | Bacteria | 4018 |
| 175 | Ga0466708_032861 | 3300042652 | Unclassified | 11207 |
| 176 | Ga0466708_150246 | 3300042652 | Bacteria | 29417 |
| 177 | Ga0466708_195728 | 3300042652 | Bacteria | 9960 |
| 178 | Ga0466727_309121 | 3300042655 | Bacteria | 2874 |
| 179 | Ga0068302_10013629 | 3300005071 | Bacteria | 25592 |
| 180 | Ga0068302_10314310 | 3300005071 | Bacteria | 1408 |
| 181 | Ga0466705_464266 | 3300042612 | Unclassified | 1358 |
| 182 | Ga0466711_159388 | 3300042615 | Bacteria | 5472 |
| 183 | Ga0466711_389539 | 3300042615 | Bacteria | 2761 |
| 184 | Ga0466726_203234 | 3300042619 | Bacteria | 2084 |
| 185 | Ga0466726_410566 | 3300042619 | Bacteria | 2527 |
| 186 | Ga0466728_235834 | 3300042620 | Bacteria | 17793 |
| 187 | Ga0466729_097723 | 3300042621 | Bacteria | 3389 |
| 188 | Ga0466713_088843 | 3300042602 | Bacteria | 126256 |
| 189 | Ga0466719_158558 | 3300042606 | Bacteria | 1535 |
| 190 | Ga0466719_523742 | 3300042606 | Bacteria | 2326 |
| 191 | Ga0123356_10037569 | 3300010049 | Bacteria | 4517 |
| 192 | Ga0123356_10107502 | 3300010049 | Bacteria | 2688 |
| 193 | Ga0123356_10367240 | 3300010049 | Bacteria | 1568 |
| 194 | Ga0123353_10000058 | 3300010167 | Bacteria | 125313 |
| 195 | Ga0456237_0005375 | 3300041968 | Bacteria | 2032 |
| 196 | Ga0466690_121301 | 3300042590 | Bacteria | 10362 |
| 197 | Ga0466690_213551 | 3300042590 | Bacteria | 1014 |
| 198 | Ga0466691_100027 | 3300042593 | Bacteria | 28076 |
| 199 | Ga0466699_039630 | 3300042597 | Bacteria | 2864 |
| 200 | Ga0466704_079617 | 3300042643 | Bacteria | 17323 |
| 201 | Ga0466704_184155 | 3300042643 | Bacteria | 22496 |
| 202 | Ga0466709_226877 | 3300042648 | Bacteria | 11155 |
| 203 | Ga0466727_010179 | 3300042655 | Bacteria | 1184 |
| 204 | Ga0466727_078040 | 3300042655 | Bacteria | 21458 |
| 205 | Ga0466727_329282 | 3300042655 | Bacteria | 2017 |
| 206 | Ga0466711_091584 | 3300042615 | Bacteria | 27785 |
| 207 | Ga0466711_221526 | 3300042615 | Bacteria | 17842 |
| 208 | Ga0466715_473422 | 3300042616 | Bacteria | 47885 |
| 209 | Ga0466726_285103 | 3300042619 | Bacteria | 7085 |
| 210 | Ga0466726_308142 | 3300042619 | Bacteria | 1858 |
| 211 | Ga0466726_338936 | 3300042619 | Bacteria | 8121 |
| 212 | Ga0466726_343509 | 3300042619 | Bacteria | 2040 |
| 213 | Ga0466728_227025 | 3300042620 | Bacteria | 1528 |
| 214 | Ga0466705_010987 | 3300042612 | Bacteria | 4464 |
| 215 | Ga0466706_221335 | 3300042599 | Bacteria | 4775 |
| 216 | Ga0466700_104273 | 3300042600 | Bacteria | 4873 |
| 217 | Ga0466707_162812 | 3300042601 | Bacteria | 3347 |
| 218 | Ga0466707_211675 | 3300042601 | Bacteria | 7280 |
| 219 | Ga0466707_265867 | 3300042601 | Bacteria | 10333 |
| 220 | Ga0466707_298640 | 3300042601 | Bacteria | 4353 |
| 221 | Ga0466713_025801 | 3300042602 | Bacteria | 3817 |
| 222 | Ga0466719_017968 | 3300042606 | Bacteria | 23625 |
| 223 | Ga0466722_132802 | 3300042609 | Bacteria | 16844 |
| 224 | Ga0123357_10415998 | 3300009784 | Bacteria | 1205 |
| 225 | Ga0123356_10177118 | 3300010049 | Bacteria | 2150 |
| 226 | Ga0456237_0000431 | 3300041968 | Bacteria | 6318 |
| 227 | Ga0466691_047632 | 3300042593 | Bacteria | 15841 |
| 228 | Ga0466691_212996 | 3300042593 | Unclassified | 5427 |
| 229 | Ga0466696_341213 | 3300042596 | Bacteria | 5309 |
| 230 | Ga0466735_120334 | 3300042624 | Bacteria | 3344 |
| 231 | Ga0466735_232061 | 3300042624 | Bacteria | 4992 |
| 232 | Ga0466703_049654 | 3300042636 | Bacteria | 3297 |
| 233 | Ga0466703_172117 | 3300042636 | Bacteria | 1411 |
| 234 | Ga0466703_246886 | 3300042636 | Unclassified | 1155 |
| 235 | Ga0466704_298420 | 3300042643 | Unclassified | 3149 |
| 236 | Ga0466704_554296 | 3300042643 | Bacteria | 7866 |
| 237 | Ga0466727_279750 | 3300042655 | Unclassified | 1666 |
| 238 | Ga0466727_292746 | 3300042655 | Bacteria | 2669 |
| 239 | Ga0072941_1094543 | 3300005201 | Bacteria | 1217 |
| 240 | Ga0466711_379170 | 3300042615 | Bacteria | 1291 |
| 241 | Ga0466723_084268 | 3300042618 | Bacteria | 6563 |
| 242 | Ga0466723_220176 | 3300042618 | Bacteria | 7448 |
| 243 | Ga0466726_020193 | 3300042619 | Bacteria | 77472 |
| 244 | Ga0466726_220011 | 3300042619 | Bacteria | 2297 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10609 | ParA | NUBPL iron-transfer P-loop NTPase | 5 | 37 | 0.93 |
| PF02374 | ArsA_ATPase | Anion-transporting ATPase | 3 | 43 | 0.9 |
| PF01656 | CbiA | CobQ/CobB/MinD/ParA nucleotide binding domain | 4 | 233 | 0.89 |
| PF00142 | Fer4_NifH | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family | 1 | 42 | 0.88 |
| PF06564 | CBP_BcsQ | Cellulose biosynthesis protein BcsQ | 3 | 47 | 0.87 |
| PF13614 | AAA_31 | AAA domain | 6 | 174 | 0.69 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.