Protein Family IF09357
Metagenome
Isolate
252
Members
59
Samples
237
Scaffolds
297.15
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_099656|Ga0466704_099656_1357_2397
- Length
- 346 aa
- Sequence
- MTVTETLARGSALLTSHHIENPGLDAALLLAETLGLSREKLIQRGRDPLPAAEARRFFRLIDRRISGECTAYILGRKEFRGLDFFVNPAVLVPRPDTETLVEAALRERERRKGGXXXXKTGDRGMVPHXXXXSSRSLPLTVHYSLLDLCTGSGAVAVALKYERPEITVFASDVSPEALETARRNAVRLLGTAPEPTGTALRHAGDASALSPAVAFIQSDLFAGIPRRFHLITANPPYVKTGELAGLSREVRGEPPLALDGGEDGLDLIRAIISRAPDHLFPGGALLLEADPRQMPLIVSLLEDQGFQDILSYRDLSGAERVIGGRIREQFSREQGEGDNGIGAFHI
Sample Types
Isolate
6.0%
Metagenome
94.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.6%
Unclassified
26.3%
Kalotermitidae
26.3%
Rhinotermitidae
7.0%
Termopsidae
5.3%
Formicidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
244
Eukaryota
0
Viruses
1
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 2 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 7 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 10 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 29 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 49 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 50 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 51 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 56 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 57 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 58 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_386347 | 3300042612 | Bacteria | 3138 |
| 2 | Ga0466712_012860 | 3300042614 | Bacteria | 12855 |
| 3 | Ga0466726_057617 | 3300042619 | Bacteria | 22090 |
| 4 | Ga0466728_141297 | 3300042620 | Bacteria | 3441 |
| 5 | Ga0466729_281706 | 3300042621 | Bacteria | 1606 |
| 6 | Ga0466735_060052 | 3300042624 | Bacteria | 5341 |
| 7 | Ga0466703_001555 | 3300042636 | Bacteria | 31320 |
| 8 | Ga0466703_078204 | 3300042636 | Bacteria | 1541 |
| 9 | Ga0466704_031481 | 3300042643 | Bacteria | 7802 |
| 10 | Ga0466704_129576 | 3300042643 | Bacteria | 15460 |
| 11 | Ga0466709_028731 | 3300042648 | Bacteria | 28719 |
| 12 | Ga0466709_078322 | 3300042648 | Bacteria | 34193 |
| 13 | Ga0466709_298156 | 3300042648 | Bacteria | 51626 |
| 14 | Ga0466707_289463 | 3300042601 | Bacteria | 2098 |
| 15 | Ga0466707_354486 | 3300042601 | Bacteria | 1953 |
| 16 | Ga0466716_061030 | 3300042605 | Unclassified | 2180 |
| 17 | Ga0466720_112470 | 3300042607 | Bacteria | 2918 |
| 18 | Ga0466722_145526 | 3300042609 | Bacteria | 5676 |
| 19 | Ga0123355_10408512 | 3300009826 | Bacteria | 1745 |
| 20 | Ga0415639_047326 | 3300038395 | Bacteria | 2597 |
| 21 | Ga0466690_138190 | 3300042590 | Bacteria | 2824 |
| 22 | Ga0466690_350329 | 3300042590 | Bacteria | 2263 |
| 23 | Ga0466696_244438 | 3300042596 | Bacteria | 14154 |
| 24 | Ga0466696_348436 | 3300042596 | Bacteria | 14309 |
| 25 | Ga0466699_024719 | 3300042597 | Bacteria | 3990 |
| 26 | JGI24698J34947_10002549 | 3300002449 | Bacteria | 9834 |
| 27 | JGI24698J34947_10004256 | 3300002449 | Bacteria | 7785 |
| 28 | JGI24698J34947_10032553 | 3300002449 | Bacteria | 2737 |
| 29 | JGI24698J34947_10037379 | 3300002449 | Bacteria | 2522 |
| 30 | JGI24698J34947_10042255 | 3300002449 | Unclassified | 2343 |
| 31 | JGI24698J34947_10075656 | 3300002449 | Unclassified | 1600 |
| 32 | JGI24695J34938_10009767 | 3300002450 | Bacteria | 5311 |
| 33 | Ga0072940_1046131 | 3300005200 | Bacteria | 1354 |
| 34 | Ga0466715_534778 | 3300042616 | Bacteria | 25308 |
| 35 | Ga0466723_043430 | 3300042618 | Bacteria | 3259 |
| 36 | Ga0466723_341319 | 3300042618 | Bacteria | 9598 |
| 37 | Ga0466728_180542 | 3300042620 | Bacteria | 1302 |
| 38 | Ga0466729_099218 | 3300042621 | Bacteria | 2404 |
| 39 | Ga0466703_061316 | 3300042636 | Bacteria | 6080 |
| 40 | Ga0466703_225872 | 3300042636 | Bacteria | 13067 |
| 41 | Ga0466704_304583 | 3300042643 | Bacteria | 47429 |
| 42 | Ga0466704_516745 | 3300042643 | Bacteria | 38501 |
| 43 | Ga0466709_266318 | 3300042648 | Bacteria | 2545 |
| 44 | Ga0466716_063393 | 3300042605 | Bacteria | 14618 |
| 45 | Ga0466716_308332 | 3300042605 | Bacteria | 1564 |
| 46 | Ga0466722_038042 | 3300042609 | Bacteria | 14028 |
| 47 | Ga0123356_10049357 | 3300010049 | Bacteria | 3917 |
| 48 | Ga0456237_0000742 | 3300041968 | Bacteria | 5032 |
| 49 | Ga0466696_026885 | 3300042596 | Bacteria | 6056 |
| 50 | Ga0466696_027140 | 3300042596 | Bacteria | 5319 |
| 51 | Ga0466696_272484 | 3300042596 | Bacteria | 24883 |
| 52 | JGI24695J34938_10003372 | 3300002450 | Unclassified | 11223 |
| 53 | Ga0466712_047332 | 3300042614 | Bacteria | 3051 |
| 54 | Ga0466715_117360 | 3300042616 | Bacteria | 2267 |
| 55 | Ga0466715_140120 | 3300042616 | Bacteria | 5610 |
| 56 | Ga0466723_067599 | 3300042618 | Bacteria | 49452 |
| 57 | Ga0466726_030714 | 3300042619 | Bacteria | 8783 |
| 58 | Ga0466726_068479 | 3300042619 | Bacteria | 1661 |
| 59 | Ga0466728_229209 | 3300042620 | Bacteria | 4426 |
| 60 | Ga0466709_160554 | 3300042648 | Bacteria | 1925 |
| 61 | Ga0466709_161757 | 3300042648 | Bacteria | 27099 |
| 62 | Ga0466708_024018 | 3300042652 | Bacteria | 1284 |
| 63 | Ga0466708_072677 | 3300042652 | Bacteria | 2389 |
| 64 | Ga0466708_256484 | 3300042652 | Bacteria | 5385 |
| 65 | Ga0466708_438831 | 3300042652 | Bacteria | 1091 |
| 66 | Ga0466727_070472 | 3300042655 | Bacteria | 4216 |
| 67 | Ga0466706_232716 | 3300042599 | Bacteria | 2068 |
| 68 | Ga0466716_250017 | 3300042605 | Bacteria | 4397 |
| 69 | Ga0466719_508256 | 3300042606 | Bacteria | 33396 |
| 70 | Ga0466722_003553 | 3300042609 | Bacteria | 9691 |
| 71 | Ga0466722_060129 | 3300042609 | Bacteria | 14505 |
| 72 | Ga0466722_078838 | 3300042609 | Bacteria | 2719 |
| 73 | Ga0466722_085711 | 3300042609 | Bacteria | 5132 |
| 74 | Ga0466722_124551 | 3300042609 | Bacteria | 9011 |
| 75 | Ga0466722_211753 | 3300042609 | Bacteria | 11491 |
| 76 | Ga0123356_10000598 | 3300010049 | Bacteria | 40012 |
| 77 | Ga0466690_047302 | 3300042590 | Bacteria | 10255 |
| 78 | Ga0466690_118173 | 3300042590 | Bacteria | 1642 |
| 79 | JGI24695J34938_10005334 | 3300002450 | Bacteria | 8044 |
| 80 | JGI24695J34938_10059000 | 3300002450 | Bacteria | 1643 |
| 81 | JGI24699J35502_11117773 | 3300002509 | Bacteria | 3052 |
| 82 | Ga0466712_036774 | 3300042614 | Bacteria | 2994 |
| 83 | Ga0466712_149433 | 3300042614 | Bacteria | 19283 |
| 84 | Ga0466711_119221 | 3300042615 | Bacteria | 6462 |
| 85 | Ga0466711_299918 | 3300042615 | Bacteria | 30126 |
| 86 | Ga0466715_380329 | 3300042616 | Bacteria | 1315 |
| 87 | Ga0466723_024892 | 3300042618 | Bacteria | 5742 |
| 88 | Ga0466723_054483 | 3300042618 | Bacteria | 7031 |
| 89 | Ga0466723_055569 | 3300042618 | Bacteria | 2370 |
| 90 | Ga0466723_277331 | 3300042618 | Bacteria | 9909 |
| 91 | Ga0466726_375914 | 3300042619 | Bacteria | 1664 |
| 92 | Ga0466728_029635 | 3300042620 | Bacteria | 5846 |
| 93 | Ga0466728_189674 | 3300042620 | Bacteria | 3203 |
| 94 | Ga0466703_198931 | 3300042636 | Bacteria | 2495 |
| 95 | Ga0466703_202484 | 3300042636 | Bacteria | 20785 |
| 96 | Ga0466709_341490 | 3300042648 | Bacteria | 1802 |
| 97 | Ga0466708_136144 | 3300042652 | Bacteria | 34382 |
| 98 | Ga0466708_197155 | 3300042652 | Bacteria | 9848 |
| 99 | Ga0466708_381275 | 3300042652 | Bacteria | 3192 |
| 100 | Ga0466727_300927 | 3300042655 | Bacteria | 2457 |
| 101 | Ga0466716_059969 | 3300042605 | Bacteria | 3447 |
| 102 | Ga0466716_274118 | 3300042605 | Bacteria | 7476 |
| 103 | Ga0456237_0006702 | 3300041968 | Bacteria | 1796 |
| 104 | Ga0466691_083850 | 3300042593 | Bacteria | 6724 |
| 105 | Ga0466699_209712 | 3300042597 | Bacteria | 12420 |
| 106 | JGI24698J34947_10026320 | 3300002449 | Bacteria | 3091 |
| 107 | JGI24698J34947_10079650 | 3300002449 | Bacteria | 1542 |
| 108 | JGI24695J34938_10002107 | 3300002450 | Bacteria | 15597 |
| 109 | Ga0072940_1072927 | 3300005200 | Bacteria | 1650 |
| 110 | Ga0072941_1011612 | 3300005201 | Bacteria | 13707 |
| 111 | Ga0466705_114275 | 3300042612 | Bacteria | 4189 |
| 112 | Ga0466705_323703 | 3300042612 | Bacteria | 4868 |
| 113 | Ga0466732_218884 | 3300042656 | Bacteria | 1326 |
| 114 | Ga0466712_077239 | 3300042614 | Bacteria | 7508 |
| 115 | Ga0466712_079997 | 3300042614 | Bacteria | 9721 |
| 116 | Ga0466712_142798 | 3300042614 | Bacteria | 15420 |
| 117 | Ga0466718_046991 | 3300042617 | Bacteria | 3564 |
| 118 | Ga0466723_172370 | 3300042618 | Bacteria | 14030 |
| 119 | Ga0466726_179366 | 3300042619 | Bacteria | 13331 |
| 120 | Ga0466726_227138 | 3300042619 | Bacteria | 16539 |
| 121 | Ga0466728_467522 | 3300042620 | Bacteria | 1967 |
| 122 | Ga0466704_275250 | 3300042643 | Bacteria | 3820 |
| 123 | Ga0466709_015811 | 3300042648 | Bacteria | 9178 |
| 124 | Ga0466709_140536 | 3300042648 | Bacteria | 6449 |
| 125 | Ga0466709_367931 | 3300042648 | Bacteria | 8740 |
| 126 | Ga0466727_289331 | 3300042655 | Bacteria | 1359 |
| 127 | Ga0466707_122309 | 3300042601 | Bacteria | 2426 |
| 128 | Ga0466707_366808 | 3300042601 | Bacteria | 2154 |
| 129 | Ga0466716_160719 | 3300042605 | Bacteria | 1695 |
| 130 | Ga0466722_039119 | 3300042609 | Bacteria | 2152 |
| 131 | Ga0123356_10005768 | 3300010049 | Bacteria | 12568 |
| 132 | Ga0466690_066013 | 3300042590 | Bacteria | 3209 |
| 133 | Ga0466691_002663 | 3300042593 | Bacteria | 4132 |
| 134 | Ga0466691_038321 | 3300042593 | Bacteria | 6025 |
| 135 | JGI24698J34947_10073633 | 3300002449 | Bacteria | 1629 |
| 136 | JGI24695J34938_10000285 | 3300002450 | Bacteria | 49928 |
| 137 | JGI24695J34938_10008090 | 3300002450 | Bacteria | 6053 |
| 138 | JGI24695J34938_10031721 | 3300002450 | Bacteria | 2448 |
| 139 | JGI24700J35501_10911534 | 3300002508 | Bacteria | 3617 |
| 140 | Ga0466705_006529 | 3300042612 | Bacteria | 29660 |
| 141 | Ga0466705_471829 | 3300042612 | Bacteria | 51531 |
| 142 | Ga0466712_176529 | 3300042614 | Bacteria | 7612 |
| 143 | Ga0466711_072851 | 3300042615 | Bacteria | 17942 |
| 144 | Ga0466715_198936 | 3300042616 | Bacteria | 13089 |
| 145 | Ga0466715_593324 | 3300042616 | Bacteria | 2329 |
| 146 | Ga0466723_147116 | 3300042618 | Bacteria | 6919 |
| 147 | Ga0466723_242796 | 3300042618 | Bacteria | 2219 |
| 148 | Ga0466729_056926 | 3300042621 | Bacteria | 1707 |
| 149 | Ga0466703_147469 | 3300042636 | Bacteria | 10204 |
| 150 | Ga0466703_236582 | 3300042636 | Bacteria | 1448 |
| 151 | Ga0466704_054355 | 3300042643 | Bacteria | 22697 |
| 152 | Ga0466709_184770 | 3300042648 | Bacteria | 3015 |
| 153 | Ga0466708_013933 | 3300042652 | Bacteria | 7697 |
| 154 | Ga0466708_068133 | 3300042652 | Unclassified | 1506 |
| 155 | Ga0466708_108483 | 3300042652 | Bacteria | 5807 |
| 156 | Ga0466708_111799 | 3300042652 | Bacteria | 28295 |
| 157 | Ga0466708_286973 | 3300042652 | Bacteria | 5567 |
| 158 | Ga0466727_122212 | 3300042655 | Bacteria | 2246 |
| 159 | Ga0466727_296254 | 3300042655 | Bacteria | 2524 |
| 160 | Ga0466719_080983 | 3300042606 | Unclassified | 1528 |
| 161 | Ga0123353_10003678 | 3300010167 | Bacteria | 19467 |
| 162 | Ga0123353_10027206 | 3300010167 | Bacteria | 8758 |
| 163 | Ga0123353_10376040 | 3300010167 | Viruses | 2127 |
| 164 | Ga0415639_010579 | 3300038395 | Bacteria | 20403 |
| 165 | Ga0456237_0001913 | 3300041968 | Bacteria | 3358 |
| 166 | Ga0466690_078233 | 3300042590 | Bacteria | 1459 |
| 167 | Ga0466690_082488 | 3300042590 | Bacteria | 2931 |
| 168 | Ga0466692_029014 | 3300042591 | Bacteria | 31809 |
| 169 | Ga0466693_234518 | 3300042592 | Bacteria | 34454 |
| 170 | Ga0466693_293912 | 3300042592 | Bacteria | 55262 |
| 171 | Ga0466691_007206 | 3300042593 | Bacteria | 4189 |
| 172 | Ga0466696_175335 | 3300042596 | Bacteria | 5574 |
| 173 | JGI24698J34947_10005301 | 3300002449 | Bacteria | 7074 |
| 174 | JGI24698J34947_10027829 | 3300002449 | Bacteria | 2998 |
| 175 | JGI24698J34947_10097509 | 3300002449 | Bacteria | 1331 |
| 176 | JGI24695J34938_10000139 | 3300002450 | Bacteria | 65941 |
| 177 | JGI24695J34938_10000969 | 3300002450 | Bacteria | 26153 |
| 178 | JGI24695J34938_10003679 | 3300002450 | Bacteria | 10500 |
| 179 | JGI24695J34938_10007990 | 3300002450 | Bacteria | 6103 |
| 180 | Ga0466705_214462 | 3300042612 | Bacteria | 1913 |
| 181 | Ga0466712_252460 | 3300042614 | Bacteria | 1835 |
| 182 | Ga0466723_028342 | 3300042618 | Bacteria | 6399 |
| 183 | Ga0466702_276380 | 3300042635 | Unclassified | 1563 |
| 184 | Ga0466703_073957 | 3300042636 | Bacteria | 4670 |
| 185 | Ga0466703_221485 | 3300042636 | Bacteria | 16425 |
| 186 | Ga0466708_068892 | 3300042652 | Bacteria | 1533 |
| 187 | Ga0466708_147934 | 3300042652 | Bacteria | 5363 |
| 188 | Ga0466708_365476 | 3300042652 | Bacteria | 5722 |
| 189 | Ga0466707_025081 | 3300042601 | Bacteria | 1303 |
| 190 | Ga0466720_028106 | 3300042607 | Bacteria | 24586 |
| 191 | Ga0466720_165219 | 3300042607 | Bacteria | 4311 |
| 192 | Ga0466721_009895 | 3300042608 | Bacteria | 2675 |
| 193 | Ga0466722_041602 | 3300042609 | Bacteria | 19857 |
| 194 | Ga0123355_10050279 | 3300009826 | Bacteria | 6773 |
| 195 | Ga0264413_104061 | 3300024493 | Bacteria | 24138 |
| 196 | Ga0466692_007897 | 3300042591 | Bacteria | 32184 |
| 197 | Ga0466692_128105 | 3300042591 | Bacteria | 8736 |
| 198 | Ga0466691_087298 | 3300042593 | Bacteria | 6685 |
| 199 | Ga0466691_105424 | 3300042593 | Bacteria | 22452 |
| 200 | Ga0466696_194869 | 3300042596 | Bacteria | 2619 |
| 201 | Ga0466699_323384 | 3300042597 | Bacteria | 2628 |
| 202 | JGI24698J34947_10004310 | 3300002449 | Bacteria | 7746 |
| 203 | JGI24698J34947_10004643 | 3300002449 | Bacteria | 7490 |
| 204 | JGI24695J34938_10002652 | 3300002450 | Bacteria | 13353 |
| 205 | JGI24695J34938_10023445 | 3300002450 | Bacteria | 2976 |
| 206 | Ga0103267_1000049 | 3300007190 | Bacteria | 48376 |
| 207 | Ga0466705_052913 | 3300042612 | Bacteria | 7760 |
| 208 | Ga0466712_066136 | 3300042614 | Bacteria | 21806 |
| 209 | Ga0466711_179983 | 3300042615 | Bacteria | 3619 |
| 210 | Ga0466715_168443 | 3300042616 | Bacteria | 14843 |
| 211 | Ga0466723_055834 | 3300042618 | Bacteria | 18088 |
| 212 | Ga0466723_296037 | 3300042618 | Bacteria | 28470 |
| 213 | Ga0466726_457957 | 3300042619 | Bacteria | 11252 |
| 214 | Ga0466704_099656 | 3300042643 | Bacteria | 4398 |
| 215 | Ga0466704_198630 | 3300042643 | Bacteria | 14714 |
| 216 | Ga0466704_224514 | 3300042643 | Bacteria | 59923 |
| 217 | Ga0466704_340491 | 3300042643 | Bacteria | 6704 |
| 218 | Ga0466709_086715 | 3300042648 | Bacteria | 6283 |
| 219 | Ga0466719_402616 | 3300042606 | Bacteria | 26923 |
| 220 | Ga0123357_10112026 | 3300009784 | Bacteria | 3475 |
| 221 | Ga0123355_10316728 | 3300009826 | Bacteria | 2107 |
| 222 | Ga0123353_10281756 | 3300010167 | Bacteria | 2552 |
| 223 | Ga0415639_255082 | 3300038395 | Bacteria | 2404 |
| 224 | Ga0466690_186864 | 3300042590 | Bacteria | 7563 |
| 225 | Ga0466692_015361 | 3300042591 | Bacteria | 56574 |
| 226 | Ga0466692_054861 | 3300042591 | Bacteria | 3892 |
| 227 | Ga0466692_103049 | 3300042591 | Bacteria | 3260 |
| 228 | Ga0466692_113661 | 3300042591 | Bacteria | 4746 |
| 229 | Ga0466691_015001 | 3300042593 | Bacteria | 24199 |
| 230 | Ga0466691_073970 | 3300042593 | Bacteria | 40551 |
| 231 | Ga0466691_176972 | 3300042593 | Bacteria | 3499 |
| 232 | Ga0466696_043219 | 3300042596 | Bacteria | 1351 |
| 233 | JGI24698J34947_10005807 | 3300002449 | Bacteria | 6767 |
| 234 | JGI24695J34938_10000191 | 3300002450 | Bacteria | 57182 |
| 235 | JGI24695J34938_10025559 | 3300002450 | Bacteria | 2821 |
| 236 | Ga0072941_1041839 | 3300005201 | Bacteria | 3434 |
| 237 | Ga0072941_1048100 | 3300005201 | Bacteria | 2376 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF05175 | GO:0008168 | methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.