Protein Family IF09313
Metagenome
Isolate
134
Members
57
Samples
128
Scaffolds
373.51
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_020556|Ga0466704_020556_22825_24045
- Length
- 406 aa
- Sequence
- MELKKDADLSEISFHILCFTFYVYLYGMKEEKLHNPFLVAGYYSPAYFCDRETETEKIISALSNNRNISLISPRRFGKTGLIHHVFYHLKAQKNEVYCFYIDIFSTQNLSDFVQLLAKTILGKLDNYSEKTLKGISGIFKSFRPAFSFDTLTGIPTITLDIRPEQVQSGLQEIFTYLQQSGKRCYIAIDEFQQITEYPEKGVEALLRSYIQFSDQVKFIFSGSKKHLMDAMFSSVNRPFYQSTQKIGLKEIPLATYSPFAENLFAQYGKHLDSSIFKTVYHTVLGHTWYIQFILNQLFSLMQKDYSESDVTEIVSDVLQEENATYKTYCELLTKGQLRLLTAIAKERKVNAPFQTSFLQKHHLTAVSSVKLALKSLIDKTLVLKDDEGNYFVYDRFFALWLEEAFK
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.6%
Kalotermitidae
15.8%
Unclassified
12.3%
Termopsidae
7.0%
Rhinotermitidae
5.3%
Passalidae
3.5%
Hodotermitidae
1.8%
Blattidae
1.8%
Taxonomy
Archaea
0
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 2 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 3 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 35 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 52 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_315136 | 3300042616 | Bacteria | 2305 |
| 2 | Ga0466718_046236 | 3300042617 | Bacteria | 16297 |
| 3 | Ga0466700_437811 | 3300042600 | Bacteria | 57813 |
| 4 | Ga0466720_080347 | 3300042607 | Bacteria | 74454 |
| 5 | Ga0123357_10191331 | 3300009784 | Bacteria | 2357 |
| 6 | Ga0123356_10030303 | 3300010049 | Bacteria | 5064 |
| 7 | Ga0466696_251703 | 3300042596 | Bacteria | 6110 |
| 8 | Ga0466699_278010 | 3300042597 | Unclassified | 2434 |
| 9 | Ga0466729_217887 | 3300042621 | Bacteria | 2198 |
| 10 | Ga0466731_082822 | 3300042622 | Bacteria | 1831 |
| 11 | Ga0466727_059638 | 3300042655 | Bacteria | 76336 |
| 12 | JGI24702J35022_10042188 | 3300002462 | Bacteria | 2430 |
| 13 | JGI24702J35022_10107756 | 3300002462 | Bacteria | 1530 |
| 14 | JGI24699J35502_11134116 | 3300002509 | Bacteria | 32708 |
| 15 | Ga0072940_1006860 | 3300005200 | Unclassified | 3981 |
| 16 | Ga0466705_343221 | 3300042612 | Bacteria | 10993 |
| 17 | Ga0466733_029429 | 3300042659 | Bacteria | 2451 |
| 18 | Ga0466733_056702 | 3300042659 | Bacteria | 4506 |
| 19 | Ga0466728_378708 | 3300042620 | Unclassified | 3971 |
| 20 | Ga0466700_377912 | 3300042600 | Bacteria | 12580 |
| 21 | Ga0466707_130524 | 3300042601 | Bacteria | 6372 |
| 22 | Ga0466717_264791 | 3300042604 | Bacteria | 3436 |
| 23 | Ga0466717_278815 | 3300042604 | Unclassified | 6229 |
| 24 | Ga0466721_094341 | 3300042608 | Bacteria | 36475 |
| 25 | Ga0466701_013849 | 3300042598 | Unclassified | 1332 |
| 26 | Ga0466731_359227 | 3300042622 | Bacteria | 2374 |
| 27 | Ga0466702_302230 | 3300042635 | Bacteria | 9237 |
| 28 | Ga0466704_294751 | 3300042643 | Bacteria | 11001 |
| 29 | IMNBL1DRAFT_c0000082 | 3300000062 | Bacteria | 85768 |
| 30 | JGI24705J35276_12161839 | 3300002504 | Bacteria | 1237 |
| 31 | Ga0466733_186141 | 3300042659 | Bacteria | 8487 |
| 32 | Ga0466705_459466 | 3300042612 | Bacteria | 3021 |
| 33 | Ga0466715_125974 | 3300042616 | Bacteria | 4174 |
| 34 | Ga0466718_034473 | 3300042617 | Bacteria | 13761 |
| 35 | Ga0466726_044381 | 3300042619 | Unclassified | 4382 |
| 36 | Ga0466713_043210 | 3300042602 | Bacteria | 5866 |
| 37 | Ga0466698_332110 | 3300042610 | Bacteria | 1495 |
| 38 | Ga0123357_10005103 | 3300009784 | Bacteria | 15650 |
| 39 | Ga0123353_10316156 | 3300010167 | Bacteria | 2373 |
| 40 | Ga0123354_10193582 | 3300010882 | Bacteria | 2266 |
| 41 | Ga0466690_359642 | 3300042590 | Bacteria | 21085 |
| 42 | Ga0466694_265658 | 3300042594 | Bacteria | 8040 |
| 43 | Ga0466699_076648 | 3300042597 | Bacteria | 2795 |
| 44 | Ga0466735_031542 | 3300042624 | Unclassified | 2161 |
| 45 | Ga0466704_284826 | 3300042643 | Bacteria | 2150 |
| 46 | Ga0466725_088031 | 3300042654 | Bacteria | 43512 |
| 47 | AustNasuHG_c1011171 | 3300000089 | Bacteria | 3115 |
| 48 | AustNasuHG_c1022226 | 3300000089 | Bacteria | 2040 |
| 49 | JGI24702J35022_10011161 | 3300002462 | Bacteria | 5004 |
| 50 | JGI24702J35022_10022690 | 3300002462 | Bacteria | 3394 |
| 51 | JGI24696J40584_12926323 | 3300002834 | Bacteria | 1411 |
| 52 | Ga0466711_217784 | 3300042615 | Bacteria | 11711 |
| 53 | Ga0466715_535965 | 3300042616 | Bacteria | 1612 |
| 54 | Ga0466701_033937 | 3300042598 | Bacteria | 3030 |
| 55 | Ga0466706_218201 | 3300042599 | Unclassified | 1314 |
| 56 | Ga0466714_086554 | 3300042603 | Bacteria | 1429 |
| 57 | Ga0466722_176666 | 3300042609 | Bacteria | 2375 |
| 58 | Ga0123353_10000503 | 3300010167 | Bacteria | 48547 |
| 59 | Ga0123353_10001140 | 3300010167 | Bacteria | 32372 |
| 60 | Ga0123353_10011555 | 3300010167 | Bacteria | 12457 |
| 61 | Ga0466693_036906 | 3300042592 | Bacteria | 2769 |
| 62 | Ga0466694_182216 | 3300042594 | Bacteria | 1872 |
| 63 | JGI24702J35022_10008409 | 3300002462 | Bacteria | 5841 |
| 64 | JGI24702J35022_10011595 | 3300002462 | Bacteria | 4913 |
| 65 | Ga0466705_003856 | 3300042612 | Bacteria | 2173 |
| 66 | Ga0466733_219421 | 3300042659 | Bacteria | 19732 |
| 67 | Ga0466705_467213 | 3300042612 | Bacteria | 2196 |
| 68 | Ga0466712_170952 | 3300042614 | Unclassified | 2393 |
| 69 | Ga0466715_312086 | 3300042616 | Bacteria | 51572 |
| 70 | Ga0123356_10055030 | 3300010049 | Bacteria | 3705 |
| 71 | Ga0123354_10179521 | 3300010882 | Unclassified | 2424 |
| 72 | Ga0466693_364312 | 3300042592 | Bacteria | 2162 |
| 73 | Ga0466694_309380 | 3300042594 | Bacteria | 1675 |
| 74 | Ga0466704_020556 | 3300042643 | Bacteria | 26195 |
| 75 | Ga0466704_413891 | 3300042643 | Unclassified | 2933 |
| 76 | Ga0466708_132352 | 3300042652 | Bacteria | 26395 |
| 77 | IMNBL1DRAFT_c0005824 | 3300000062 | Bacteria | 6918 |
| 78 | IMNBL1DRAFT_c0012631 | 3300000062 | Bacteria | 3847 |
| 79 | Ga0466705_188763 | 3300042612 | Bacteria | 4011 |
| 80 | Ga0466701_074638 | 3300042598 | Bacteria | 2891 |
| 81 | Ga0466700_064691 | 3300042600 | Bacteria | 1403 |
| 82 | Ga0466719_486633 | 3300042606 | Bacteria | 2979 |
| 83 | Ga0123356_10004722 | 3300010049 | Bacteria | 14039 |
| 84 | Ga0123354_10203043 | 3300010882 | Bacteria | 2171 |
| 85 | Ga0123354_10264520 | 3300010882 | Unclassified | 1708 |
| 86 | Ga0466657_319100 | 3300042582 | Bacteria | 4819 |
| 87 | Ga0466704_611682 | 3300042643 | Unclassified | 1506 |
| 88 | JGI24702J35022_10033761 | 3300002462 | Bacteria | 2736 |
| 89 | JGI24702J35022_10050857 | 3300002462 | Bacteria | 2208 |
| 90 | JGI24702J35022_10116279 | 3300002462 | Bacteria | 1474 |
| 91 | JGI24705J35276_12197827 | 3300002504 | Bacteria | 1560 |
| 92 | JGI24696J40584_12961301 | 3300002834 | Bacteria | 13281 |
| 93 | Ga0466706_047464 | 3300042599 | Bacteria | 15725 |
| 94 | Ga0466707_262428 | 3300042601 | Bacteria | 12401 |
| 95 | Ga0466719_152512 | 3300042606 | Bacteria | 5852 |
| 96 | Ga0466720_093690 | 3300042607 | Bacteria | 51371 |
| 97 | Ga0466697_046721 | 3300042611 | Bacteria | 2801 |
| 98 | Ga0123353_10111813 | 3300010167 | Bacteria | 4399 |
| 99 | Ga0123353_10173640 | 3300010167 | Bacteria | 3419 |
| 100 | Ga0123353_10234818 | 3300010167 | Bacteria | 2855 |
| 101 | Ga0123353_10452210 | 3300010167 | Bacteria | 1890 |
| 102 | Ga0123354_10123344 | 3300010882 | Bacteria | 3327 |
| 103 | Ga0466694_319458 | 3300042594 | Bacteria | 2714 |
| 104 | Ga0466735_165580 | 3300042624 | Bacteria | 3847 |
| 105 | Ga0466704_159992 | 3300042643 | Bacteria | 6217 |
| 106 | Ga0466704_343619 | 3300042643 | Bacteria | 23042 |
| 107 | 2227470474 | 2225789004 | Unclassified | 4914 |
| 108 | 2227507944 | 2225789004 | Bacteria | 72999 |
| 109 | IMNBL1DRAFT_c0000261 | 3300000062 | Bacteria | 46561 |
| 110 | JGI24705J35276_12237007 | 3300002504 | Bacteria | 9553 |
| 111 | Ga0466705_138913 | 3300042612 | Bacteria | 3885 |
| 112 | Ga0466732_006212 | 3300042656 | Bacteria | 2736 |
| 113 | Ga0466707_136631 | 3300042601 | Bacteria | 4579 |
| 114 | Ga0466707_325532 | 3300042601 | Bacteria | 17430 |
| 115 | Ga0466720_209728 | 3300042607 | Bacteria | 4668 |
| 116 | Ga0123357_10110853 | 3300009784 | Bacteria | 3498 |
| 117 | Ga0123357_10206013 | 3300009784 | Bacteria | 2225 |
| 118 | Ga0123355_10005385 | 3300009826 | Bacteria | 18716 |
| 119 | Ga0123356_10058354 | 3300010049 | Bacteria | 3598 |
| 120 | Ga0123356_10277964 | 3300010049 | Bacteria | 1768 |
| 121 | Ga0123353_10164578 | 3300010167 | Bacteria | 3527 |
| 122 | Ga0123354_10004397 | 3300010882 | Bacteria | 19955 |
| 123 | Ga0123354_10009662 | 3300010882 | Bacteria | 14801 |
| 124 | Ga0466692_125475 | 3300042591 | Bacteria | 12070 |
| 125 | JGI24702J35022_10002450 | 3300002462 | Bacteria | 11314 |
| 126 | JGI24702J35022_10011039 | 3300002462 | Bacteria | 5035 |
| 127 | JGI24702J35022_10102949 | 3300002462 | Bacteria | 1565 |
| 128 | Ga0068302_10122751 | 3300005071 | Bacteria | 9629 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13401 | GO:0016887 | ATP hydrolysis activity | MF |
| PF01637 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.