Protein Family IF09312
Metagenome
Isolate
104
Members
36
Samples
98
Scaffolds
180.77
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_015199|Ga0466704_015199_1385_1930
- Length
- 181 aa
- Sequence
- MYYSTTYPSPVGLITLACDDDGDNLVGLWLAGQKYHGDTIPEAMIEKSAMPVFTAAKKWLNNYFAGGKPAVLDLSLAPIGGEFRQGVWGILCEIPYGEVITYGGIAKKMAVKMNKESMSSQAVGGAVGHNPISIIIPCHRVVGSNGSLTGYAGGVRTKVKLLELEGVDMSSLFVPKRGTAL
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.1%
Kalotermitidae
28.6%
Unclassified
14.3%
Passalidae
5.7%
Termopsidae
5.7%
Rhinotermitidae
2.9%
Blaberidae
2.9%
Stratiomyidae
2.9%
Taxonomy
Archaea
2
Bacteria
90
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 2 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 3 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 4 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 18 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 19 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 20 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 21 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 28 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_080272 | 3300042612 | Bacteria | 96661 |
| 2 | Ga0123356_10004939 | 3300010049 | Bacteria | 13677 |
| 3 | Ga0466657_141206 | 3300042582 | Bacteria | 1157 |
| 4 | Ga0466696_361634 | 3300042596 | Unclassified | 1078 |
| 5 | Ga0466715_627282 | 3300042616 | Bacteria | 91659 |
| 6 | Ga0466701_056357 | 3300042598 | Bacteria | 6209 |
| 7 | Ga0466717_240714 | 3300042604 | Unclassified | 1640 |
| 8 | Ga0466719_198585 | 3300042606 | Bacteria | 5409 |
| 9 | Ga0466704_025056 | 3300042643 | Bacteria | 2138 |
| 10 | Ga0466727_333230 | 3300042655 | Bacteria | 1406 |
| 11 | Ga0123356_10070064 | 3300010049 | Archaea | 3289 |
| 12 | Ga0265387_1000414 | 3300024582 | Archaea | 6755 |
| 13 | 2227665992 | 2225789004 | Bacteria | 1924 |
| 14 | JGI24705J35276_12208938 | 3300002504 | Bacteria | 1785 |
| 15 | Ga0466716_085681 | 3300042605 | Bacteria | 3222 |
| 16 | Ga0466704_107920 | 3300042643 | Bacteria | 28027 |
| 17 | Ga0466704_198307 | 3300042643 | Bacteria | 6437 |
| 18 | Ga0466704_456868 | 3300042643 | Bacteria | 15514 |
| 19 | Ga0466725_024640 | 3300042654 | Bacteria | 2701 |
| 20 | Ga0466697_146565 | 3300042611 | Bacteria | 1477 |
| 21 | Ga0123355_10002719 | 3300009826 | Bacteria | 25071 |
| 22 | Ga0123353_10003014 | 3300010167 | Bacteria | 21088 |
| 23 | Ga0123353_11435900 | 3300010167 | Unclassified | 884 |
| 24 | Ga0466715_243238 | 3300042616 | Bacteria | 9547 |
| 25 | Ga0466728_121645 | 3300042620 | Unclassified | 1328 |
| 26 | Ga0466717_225984 | 3300042604 | Bacteria | 1827 |
| 27 | Ga0466716_459883 | 3300042605 | Bacteria | 38120 |
| 28 | Ga0466719_029738 | 3300042606 | Bacteria | 2165 |
| 29 | Ga0466719_033638 | 3300042606 | Bacteria | 7878 |
| 30 | Ga0466704_048319 | 3300042643 | Bacteria | 15519 |
| 31 | Ga0466704_372379 | 3300042643 | Bacteria | 3551 |
| 32 | Ga0466704_426582 | 3300042643 | Bacteria | 29004 |
| 33 | Ga0466704_480169 | 3300042643 | Bacteria | 1808 |
| 34 | Ga0466704_533642 | 3300042643 | Bacteria | 39754 |
| 35 | Ga0466705_024467 | 3300042612 | Bacteria | 4134 |
| 36 | Ga0466705_116026 | 3300042612 | Unclassified | 1765 |
| 37 | Ga0466705_126895 | 3300042612 | Bacteria | 3307 |
| 38 | Ga0123356_10021104 | 3300010049 | Bacteria | 6157 |
| 39 | Ga0123356_12011741 | 3300010049 | Bacteria | 721 |
| 40 | Ga0123353_10249813 | 3300010167 | Unclassified | 2748 |
| 41 | Ga0466705_512711 | 3300042612 | Bacteria | 6945 |
| 42 | Ga0466715_165556 | 3300042616 | Bacteria | 4651 |
| 43 | Ga0466701_081833 | 3300042598 | Bacteria | 15887 |
| 44 | Ga0466700_009893 | 3300042600 | Bacteria | 32669 |
| 45 | Ga0466717_053942 | 3300042604 | Bacteria | 1249 |
| 46 | Ga0466716_285532 | 3300042605 | Bacteria | 4394 |
| 47 | Ga0466704_432955 | 3300042643 | Bacteria | 7192 |
| 48 | Ga0466705_005877 | 3300042612 | Bacteria | 1026 |
| 49 | Ga0123355_10174947 | 3300009826 | Bacteria | 3199 |
| 50 | Ga0123356_10051636 | 3300010049 | Bacteria | 3824 |
| 51 | Ga0123356_10277407 | 3300010049 | Bacteria | 1769 |
| 52 | Ga0466705_407907 | 3300042612 | Bacteria | 1468 |
| 53 | Ga0466710_224856 | 3300042613 | Bacteria | 2465 |
| 54 | Ga0466711_463522 | 3300042615 | Bacteria | 1651 |
| 55 | Ga0466713_105936 | 3300042602 | Bacteria | 2178 |
| 56 | Ga0466717_084187 | 3300042604 | Bacteria | 1148 |
| 57 | Ga0466703_166063 | 3300042636 | Bacteria | 21517 |
| 58 | Ga0466703_279441 | 3300042636 | Bacteria | 1209 |
| 59 | Ga0466703_366862 | 3300042636 | Bacteria | 18220 |
| 60 | Ga0466704_096048 | 3300042643 | Bacteria | 9093 |
| 61 | Ga0466709_137019 | 3300042648 | Bacteria | 3421 |
| 62 | Ga0466705_338842 | 3300042612 | Bacteria | 8262 |
| 63 | Ga0123353_10894367 | 3300010167 | Unclassified | 1210 |
| 64 | Ga0466728_120078 | 3300042620 | Bacteria | 10112 |
| 65 | Ga0466728_352331 | 3300042620 | Bacteria | 5541 |
| 66 | Ga0466728_422203 | 3300042620 | Bacteria | 1083 |
| 67 | Ga0466729_069262 | 3300042621 | Bacteria | 2300 |
| 68 | Ga0466719_108278 | 3300042606 | Bacteria | 39017 |
| 69 | Ga0466704_013249 | 3300042643 | Bacteria | 1182 |
| 70 | Ga0466704_015199 | 3300042643 | Bacteria | 2206 |
| 71 | Ga0466704_183703 | 3300042643 | Bacteria | 4832 |
| 72 | Ga0466704_488503 | 3300042643 | Unclassified | 1361 |
| 73 | Ga0466727_340611 | 3300042655 | Bacteria | 1274 |
| 74 | Ga0466705_012800 | 3300042612 | Bacteria | 2165 |
| 75 | Ga0466705_158788 | 3300042612 | Bacteria | 1751 |
| 76 | Ga0466732_434277 | 3300042656 | Unclassified | 2038 |
| 77 | Ga0123355_10697027 | 3300009826 | Bacteria | 1167 |
| 78 | Ga0123353_10613404 | 3300010167 | Unclassified | 1551 |
| 79 | Ga0466705_524933 | 3300042612 | Bacteria | 4475 |
| 80 | Ga0466715_013196 | 3300042616 | Bacteria | 5759 |
| 81 | Ga0466717_164278 | 3300042604 | Bacteria | 1722 |
| 82 | Ga0466716_175628 | 3300042605 | Bacteria | 4524 |
| 83 | Ga0466719_191749 | 3300042606 | Bacteria | 3225 |
| 84 | Ga0466704_032364 | 3300042643 | Bacteria | 12785 |
| 85 | Ga0466704_201577 | 3300042643 | Bacteria | 32720 |
| 86 | Ga0466709_390422 | 3300042648 | Unclassified | 8329 |
| 87 | Ga0466727_043511 | 3300042655 | Bacteria | 1422 |
| 88 | Ga0466705_018346 | 3300042612 | Bacteria | 13177 |
| 89 | Ga0466705_149429 | 3300042612 | Bacteria | 4879 |
| 90 | Ga0466705_162341 | 3300042612 | Bacteria | 9396 |
| 91 | Ga0466705_164435 | 3300042612 | Bacteria | 1820 |
| 92 | Ga0466733_124488 | 3300042659 | Bacteria | 17011 |
| 93 | Ga0123353_10161197 | 3300010167 | Bacteria | 3571 |
| 94 | IMNBL1DRAFT_c0000004 | 3300000062 | Bacteria | 271062 |
| 95 | Ga0466705_438079 | 3300042612 | Bacteria | 1346 |
| 96 | Ga0466719_170556 | 3300042606 | Unclassified | 3105 |
| 97 | Ga0466735_050890 | 3300042624 | Bacteria | 1026 |
| 98 | Ga0466704_305068 | 3300042643 | Bacteria | 3373 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.