Protein Family IF09256
Metagenome
Isolate
251
Members
73
Samples
225
Scaffolds
363.33
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_316059|Ga0466703_316059_1273_2472
- Length
- 399 aa
- Sequence
- MRPKTRPAGKNKPVYFVLLPACTIFAANINNTTYNIMTKEAYLQILSHFIPEENAVDATPFGNGHINDTLKITTASGTAEYILQRINHLIFTNVDMLQDNIRIVTSHIRKKLEERGETDIDRKVLTFLPAKDGRQYYYDGENYWRVCLMIPGSKSLEEITPELSYEAGKAFGDFQSMLADIPDGTLGETIPNFHNMEFRLQQFRDALKTDVAGRSDSVANLVDEIEKRAKAMCVQEELYREGKLKKRINHCDTKVNNILFDDISGKVLCVIDLDTVMPGYVLSDIGDFIRTGANTGAEDDADLNRVNVNMEIFKSYTRGYMETARSFLTPTEICLLPYGGRLLTYMQAVRFFTDYINGDTYYKIHHPEHNLQRTKAQFKLLQSLEEHAAEMDSFMNEWL
Sample Types
Isolate
10.4%
Metagenome
89.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.6%
Termitidae
25.0%
Kalotermitidae
19.4%
Unclassified
8.3%
Termopsidae
5.6%
Rhinotermitidae
5.6%
Passalidae
4.2%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
245
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 23 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 24 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 25 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 32 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 33 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 34 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 35 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 36 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 37 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 45 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 46 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 47 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 48 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 54 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 55 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 56 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 57 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 59 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 60 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 61 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 62 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 63 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 64 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 65 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 66 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 67 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 68 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 69 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 70 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 71 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 72 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 73 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_100994 | 3300042590 | Bacteria | 8389 |
| 2 | Ga0466701_010032 | 3300042598 | Bacteria | 6619 |
| 3 | Ga0466705_059570 | 3300042612 | Bacteria | 4959 |
| 4 | Ga0466733_090310 | 3300042659 | Bacteria | 9088 |
| 5 | Ga0466733_155467 | 3300042659 | Bacteria | 4093 |
| 6 | IMNBL1DRAFT_c0004307 | 3300000062 | Bacteria | 8601 |
| 7 | Ga0068305_10033366 | 3300005083 | Bacteria | 9897 |
| 8 | Ga0466703_185505 | 3300042636 | Unclassified | 3568 |
| 9 | Ga0466703_233846 | 3300042636 | Bacteria | 8674 |
| 10 | Ga0466703_316059 | 3300042636 | Bacteria | 10820 |
| 11 | Ga0466709_172228 | 3300042648 | Unclassified | 4707 |
| 12 | Ga0466727_031912 | 3300042655 | Bacteria | 4287 |
| 13 | Ga0466706_137590 | 3300042599 | Bacteria | 25056 |
| 14 | Ga0466706_174110 | 3300042599 | Bacteria | 65436 |
| 15 | Ga0466700_348423 | 3300042600 | Bacteria | 2977 |
| 16 | Ga0466707_015385 | 3300042601 | Bacteria | 25153 |
| 17 | Ga0466707_044362 | 3300042601 | Bacteria | 15253 |
| 18 | Ga0466713_102224 | 3300042602 | Bacteria | 5047 |
| 19 | Ga0466716_230301 | 3300042605 | Bacteria | 8125 |
| 20 | Ga0466715_179793 | 3300042616 | Bacteria | 32829 |
| 21 | Ga0466715_402619 | 3300042616 | Bacteria | 10360 |
| 22 | Ga0466728_050282 | 3300042620 | Bacteria | 2082 |
| 23 | Ga0466728_119942 | 3300042620 | Bacteria | 14483 |
| 24 | Ga0123357_10137710 | 3300009784 | Bacteria | 3013 |
| 25 | Ga0123354_10208972 | 3300010882 | Bacteria | 2116 |
| 26 | Ga0466691_020182 | 3300042593 | Bacteria | 3608 |
| 27 | Ga0466696_505291 | 3300042596 | Bacteria | 1234 |
| 28 | Ga0466705_163162 | 3300042612 | Bacteria | 2035 |
| 29 | Ga0466705_221322 | 3300042612 | Unclassified | 6855 |
| 30 | Ga0466733_051389 | 3300042659 | Bacteria | 26062 |
| 31 | Ga0466733_121822 | 3300042659 | Bacteria | 48145 |
| 32 | Ga0068305_10478872 | 3300005083 | Bacteria | 2388 |
| 33 | Ga0072940_1170650 | 3300005200 | Bacteria | 3571 |
| 34 | Ga0123357_10000367 | 3300009784 | Bacteria | 42582 |
| 35 | Ga0466703_153409 | 3300042636 | Bacteria | 8404 |
| 36 | Ga0466708_232266 | 3300042652 | Bacteria | 65416 |
| 37 | Ga0466706_006423 | 3300042599 | Bacteria | 17335 |
| 38 | Ga0466706_064516 | 3300042599 | Bacteria | 2411 |
| 39 | Ga0466706_187753 | 3300042599 | Bacteria | 2008 |
| 40 | Ga0466700_372979 | 3300042600 | Bacteria | 16369 |
| 41 | Ga0466707_219949 | 3300042601 | Bacteria | 9021 |
| 42 | Ga0466713_025403 | 3300042602 | Bacteria | 7486 |
| 43 | Ga0466713_078517 | 3300042602 | Bacteria | 38050 |
| 44 | Ga0466719_101062 | 3300042606 | Bacteria | 11428 |
| 45 | Ga0466711_182451 | 3300042615 | Bacteria | 12457 |
| 46 | Ga0466711_214305 | 3300042615 | Unclassified | 4234 |
| 47 | Ga0466711_248030 | 3300042615 | Bacteria | 3515 |
| 48 | Ga0123357_10036395 | 3300009784 | Bacteria | 6697 |
| 49 | Ga0123357_10088505 | 3300009784 | Bacteria | 4046 |
| 50 | Ga0123356_10010452 | 3300010049 | Bacteria | 9111 |
| 51 | Ga0123354_10022400 | 3300010882 | Bacteria | 9961 |
| 52 | Ga0123354_10220335 | 3300010882 | Bacteria | 2018 |
| 53 | Ga0466691_027483 | 3300042593 | Bacteria | 11835 |
| 54 | Ga0466691_051170 | 3300042593 | Bacteria | 30156 |
| 55 | Ga0466691_129429 | 3300042593 | Unclassified | 1295 |
| 56 | Ga0466705_171855 | 3300042612 | Bacteria | 2031 |
| 57 | Ga0466733_109086 | 3300042659 | Bacteria | 1315 |
| 58 | Ga0466733_122024 | 3300042659 | Bacteria | 33739 |
| 59 | 2227008139 | 2225789003 | Bacteria | 25289 |
| 60 | Ga0466727_005802 | 3300042655 | Bacteria | 23418 |
| 61 | Ga0466727_029217 | 3300042655 | Bacteria | 11764 |
| 62 | Ga0466706_049801 | 3300042599 | Bacteria | 15358 |
| 63 | Ga0466707_268938 | 3300042601 | Bacteria | 7843 |
| 64 | Ga0466707_319478 | 3300042601 | Bacteria | 19593 |
| 65 | Ga0466716_394480 | 3300042605 | Bacteria | 13439 |
| 66 | Ga0466719_261306 | 3300042606 | Bacteria | 8701 |
| 67 | Ga0466722_140561 | 3300042609 | Bacteria | 3849 |
| 68 | Ga0466711_265940 | 3300042615 | Bacteria | 5654 |
| 69 | Ga0466715_596124 | 3300042616 | Bacteria | 2839 |
| 70 | Ga0466726_249833 | 3300042619 | Bacteria | 3564 |
| 71 | Ga0466728_128512 | 3300042620 | Bacteria | 23920 |
| 72 | Ga0466729_161646 | 3300042621 | Bacteria | 17368 |
| 73 | Ga0466690_017517 | 3300042590 | Bacteria | 22678 |
| 74 | JGI24702J35022_10001996 | 3300002462 | Bacteria | 12576 |
| 75 | JGI24699J35502_11133236 | 3300002509 | Bacteria | 9343 |
| 76 | Ga0466735_121060 | 3300042624 | Bacteria | 5156 |
| 77 | Ga0466703_169194 | 3300042636 | Bacteria | 21513 |
| 78 | Ga0466709_159970 | 3300042648 | Bacteria | 21375 |
| 79 | Ga0466709_209153 | 3300042648 | Bacteria | 4039 |
| 80 | Ga0466709_266579 | 3300042648 | Bacteria | 1922 |
| 81 | Ga0466708_062073 | 3300042652 | Bacteria | 36526 |
| 82 | Ga0466727_114001 | 3300042655 | Bacteria | 13896 |
| 83 | Ga0466701_037885 | 3300042598 | Bacteria | 1779 |
| 84 | Ga0466706_074381 | 3300042599 | Bacteria | 5346 |
| 85 | Ga0466700_111184 | 3300042600 | Bacteria | 1385 |
| 86 | Ga0466700_228154 | 3300042600 | Bacteria | 1812 |
| 87 | Ga0466713_108245 | 3300042602 | Bacteria | 8278 |
| 88 | Ga0466713_154725 | 3300042602 | Bacteria | 4472 |
| 89 | Ga0466716_173890 | 3300042605 | Bacteria | 2342 |
| 90 | Ga0466719_017739 | 3300042606 | Bacteria | 2463 |
| 91 | Ga0466719_542899 | 3300042606 | Bacteria | 3872 |
| 92 | Ga0466710_202459 | 3300042613 | Bacteria | 2547 |
| 93 | Ga0466711_101292 | 3300042615 | Bacteria | 10482 |
| 94 | Ga0466711_387534 | 3300042615 | Bacteria | 9267 |
| 95 | Ga0466715_082092 | 3300042616 | Bacteria | 7411 |
| 96 | Ga0466715_175518 | 3300042616 | Bacteria | 23921 |
| 97 | Ga0466723_147177 | 3300042618 | Bacteria | 19938 |
| 98 | Ga0466723_182800 | 3300042618 | Bacteria | 17816 |
| 99 | Ga0466723_283671 | 3300042618 | Bacteria | 34853 |
| 100 | Ga0466728_021535 | 3300042620 | Bacteria | 23157 |
| 101 | Ga0123354_10156397 | 3300010882 | Bacteria | 2732 |
| 102 | Ga0466656_132052 | 3300042550 | Bacteria | 6819 |
| 103 | Ga0466690_351580 | 3300042590 | Bacteria | 4819 |
| 104 | Ga0466696_049852 | 3300042596 | Bacteria | 8685 |
| 105 | Ga0466696_091237 | 3300042596 | Bacteria | 32558 |
| 106 | Ga0466696_446440 | 3300042596 | Bacteria | 7619 |
| 107 | JGI24702J35022_10002837 | 3300002462 | Bacteria | 10498 |
| 108 | JGI24699J35502_11133941 | 3300002509 | Bacteria | 20335 |
| 109 | Ga0068302_10145667 | 3300005071 | Bacteria | 2629 |
| 110 | Ga0072941_1319770 | 3300005201 | Bacteria | 4840 |
| 111 | Ga0466703_308252 | 3300042636 | Bacteria | 9658 |
| 112 | Ga0466704_033887 | 3300042643 | Bacteria | 25154 |
| 113 | Ga0466704_609445 | 3300042643 | Bacteria | 11734 |
| 114 | Ga0466727_030629 | 3300042655 | Bacteria | 6352 |
| 115 | Ga0466707_294654 | 3300042601 | Bacteria | 15152 |
| 116 | Ga0466713_040477 | 3300042602 | Bacteria | 5085 |
| 117 | Ga0466716_300817 | 3300042605 | Bacteria | 4070 |
| 118 | Ga0466705_417481 | 3300042612 | Bacteria | 15438 |
| 119 | Ga0466711_113902 | 3300042615 | Bacteria | 12690 |
| 120 | Ga0466711_239934 | 3300042615 | Bacteria | 17196 |
| 121 | Ga0466715_029087 | 3300042616 | Bacteria | 29670 |
| 122 | Ga0466715_374572 | 3300042616 | Bacteria | 13915 |
| 123 | Ga0466726_281215 | 3300042619 | Bacteria | 8225 |
| 124 | Ga0466729_182972 | 3300042621 | Bacteria | 2844 |
| 125 | Ga0123357_10033523 | 3300009784 | Bacteria | 6978 |
| 126 | Ga0123354_10008326 | 3300010882 | Bacteria | 15749 |
| 127 | Ga0123354_10198123 | 3300010882 | Bacteria | 2220 |
| 128 | Ga0466692_051369 | 3300042591 | Bacteria | 55044 |
| 129 | Ga0466691_177719 | 3300042593 | Bacteria | 3888 |
| 130 | Ga0466696_337794 | 3300042596 | Bacteria | 26646 |
| 131 | Ga0466705_013217 | 3300042612 | Bacteria | 6141 |
| 132 | Ga0466705_026980 | 3300042612 | Bacteria | 6832 |
| 133 | IMNBL1DRAFT_c0002161 | 3300000062 | Bacteria | 13920 |
| 134 | IMNBL1DRAFT_c0004295 | 3300000062 | Bacteria | 8613 |
| 135 | JGI24698J34947_10059291 | 3300002449 | Bacteria | 1892 |
| 136 | JGI24702J35022_10008303 | 3300002462 | Bacteria | 5885 |
| 137 | JGI24702J35022_10047887 | 3300002462 | Bacteria | 2276 |
| 138 | Ga0068305_10008378 | 3300005083 | Bacteria | 3023 |
| 139 | Ga0123357_10002104 | 3300009784 | Bacteria | 21901 |
| 140 | Ga0466735_135406 | 3300042624 | Bacteria | 11141 |
| 141 | Ga0466735_154591 | 3300042624 | Bacteria | 6916 |
| 142 | Ga0466704_413586 | 3300042643 | Bacteria | 18227 |
| 143 | Ga0466704_430307 | 3300042643 | Bacteria | 5236 |
| 144 | Ga0466704_494994 | 3300042643 | Bacteria | 12479 |
| 145 | Ga0466709_204840 | 3300042648 | Bacteria | 13599 |
| 146 | Ga0466725_461920 | 3300042654 | Bacteria | 38511 |
| 147 | Ga0466706_110476 | 3300042599 | Bacteria | 25593 |
| 148 | Ga0466707_399219 | 3300042601 | Bacteria | 6187 |
| 149 | Ga0466713_110186 | 3300042602 | Bacteria | 10546 |
| 150 | Ga0466713_119808 | 3300042602 | Bacteria | 48294 |
| 151 | Ga0466719_236854 | 3300042606 | Bacteria | 8981 |
| 152 | Ga0466711_214846 | 3300042615 | Bacteria | 20080 |
| 153 | Ga0466715_564325 | 3300042616 | Bacteria | 4814 |
| 154 | Ga0466726_109311 | 3300042619 | Bacteria | 12505 |
| 155 | Ga0466728_156808 | 3300042620 | Bacteria | 8145 |
| 156 | Ga0466729_082056 | 3300042621 | Bacteria | 4068 |
| 157 | Ga0123357_10281186 | 3300009784 | Bacteria | 1719 |
| 158 | Ga0123356_10113578 | 3300010049 | Bacteria | 2621 |
| 159 | Ga0123354_10000328 | 3300010882 | Bacteria | 44060 |
| 160 | Ga0123354_10025029 | 3300010882 | Bacteria | 9411 |
| 161 | Ga0466657_157084 | 3300042582 | Bacteria | 9567 |
| 162 | Ga0466690_356823 | 3300042590 | Bacteria | 32247 |
| 163 | Ga0466696_242324 | 3300042596 | Bacteria | 39108 |
| 164 | Ga0466696_319363 | 3300042596 | Unclassified | 2443 |
| 165 | Ga0466696_378696 | 3300042596 | Bacteria | 2120 |
| 166 | Ga0466696_428762 | 3300042596 | Bacteria | 4443 |
| 167 | Ga0466705_378217 | 3300042612 | Bacteria | 4264 |
| 168 | 2227482984 | 2225789004 | Bacteria | 21557 |
| 169 | JGI24702J35022_10040317 | 3300002462 | Bacteria | 2490 |
| 170 | Ga0068305_10018049 | 3300005083 | Bacteria | 25628 |
| 171 | Ga0466731_276589 | 3300042622 | Bacteria | 1506 |
| 172 | Ga0466735_116109 | 3300042624 | Bacteria | 2825 |
| 173 | Ga0466703_320358 | 3300042636 | Bacteria | 44545 |
| 174 | Ga0466704_071620 | 3300042643 | Bacteria | 5879 |
| 175 | Ga0466708_101648 | 3300042652 | Bacteria | 32818 |
| 176 | Ga0466727_166903 | 3300042655 | Bacteria | 44044 |
| 177 | Ga0466706_144617 | 3300042599 | Bacteria | 8422 |
| 178 | Ga0466700_003507 | 3300042600 | Bacteria | 8143 |
| 179 | Ga0466700_147130 | 3300042600 | Bacteria | 16628 |
| 180 | Ga0466713_080967 | 3300042602 | Bacteria | 10571 |
| 181 | Ga0466713_099472 | 3300042602 | Bacteria | 53957 |
| 182 | Ga0466716_163384 | 3300042605 | Bacteria | 16200 |
| 183 | Ga0466719_214636 | 3300042606 | Bacteria | 2205 |
| 184 | Ga0466698_209801 | 3300042610 | Bacteria | 4746 |
| 185 | Ga0466715_045974 | 3300042616 | Bacteria | 42084 |
| 186 | Ga0466723_092210 | 3300042618 | Bacteria | 16133 |
| 187 | Ga0466728_397926 | 3300042620 | Bacteria | 1503 |
| 188 | Ga0466728_469868 | 3300042620 | Bacteria | 2136 |
| 189 | Ga0466729_086997 | 3300042621 | Bacteria | 7065 |
| 190 | Ga0123353_10000483 | 3300010167 | Bacteria | 49148 |
| 191 | Ga0123353_10068914 | 3300010167 | Bacteria | 5681 |
| 192 | Ga0123354_10036908 | 3300010882 | Bacteria | 7615 |
| 193 | Ga0466656_104588 | 3300042550 | Bacteria | 2767 |
| 194 | Ga0466690_000575 | 3300042590 | Bacteria | 12614 |
| 195 | Ga0466690_071496 | 3300042590 | Bacteria | 13899 |
| 196 | Ga0466690_112392 | 3300042590 | Bacteria | 3134 |
| 197 | Ga0466690_128822 | 3300042590 | Bacteria | 18868 |
| 198 | Ga0466691_193013 | 3300042593 | Bacteria | 11280 |
| 199 | Ga0466697_115237 | 3300042611 | Bacteria | 2174 |
| 200 | Ga0466705_243049 | 3300042612 | Bacteria | 12728 |
| 201 | Ga0466705_248359 | 3300042612 | Bacteria | 13925 |
| 202 | Ga0466705_322938 | 3300042612 | Bacteria | 5688 |
| 203 | IMNBL1DRAFT_c0006147 | 3300000062 | Bacteria | 6637 |
| 204 | JGI24702J35022_10002564 | 3300002462 | Bacteria | 11046 |
| 205 | JGI24702J35022_10008410 | 3300002462 | Bacteria | 5841 |
| 206 | Ga0068305_10002514 | 3300005083 | Bacteria | 143111 |
| 207 | Ga0466703_114630 | 3300042636 | Bacteria | 39473 |
| 208 | Ga0466704_170415 | 3300042643 | Bacteria | 25587 |
| 209 | Ga0466704_205936 | 3300042643 | Bacteria | 9806 |
| 210 | Ga0466704_287749 | 3300042643 | Bacteria | 4440 |
| 211 | Ga0466708_245718 | 3300042652 | Bacteria | 3441 |
| 212 | Ga0466727_196576 | 3300042655 | Bacteria | 91619 |
| 213 | Ga0466727_204683 | 3300042655 | Bacteria | 5111 |
| 214 | Ga0466706_118883 | 3300042599 | Bacteria | 40809 |
| 215 | Ga0466700_494737 | 3300042600 | Bacteria | 3585 |
| 216 | Ga0466707_088828 | 3300042601 | Bacteria | 1871 |
| 217 | Ga0466707_155064 | 3300042601 | Bacteria | 11517 |
| 218 | Ga0466713_112366 | 3300042602 | Bacteria | 8887 |
| 219 | Ga0466722_010442 | 3300042609 | Bacteria | 16245 |
| 220 | Ga0466711_028589 | 3300042615 | Bacteria | 6348 |
| 221 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 222 | Ga0466723_057794 | 3300042618 | Bacteria | 23560 |
| 223 | Ga0466726_021340 | 3300042619 | Bacteria | 1583 |
| 224 | Ga0466729_094959 | 3300042621 | Bacteria | 7754 |
| 225 | Ga0123357_10241399 | 3300009784 | Bacteria | 1955 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01636 | APH | Phosphotransferase enzyme family | 58 | 303 | 0.68 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.