Protein Family IF09253
Metagenome
Isolate
115
Members
53
Samples
102
Scaffolds
412.59
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_312847|Ga0466703_312847_7426_8757
- Length
- 443 aa
- Sequence
- VLFLPAPGQKGEPLDIKNTKRRALNIFDIDLWSEIWITITRNKMRSLLTGFGVFWGIFMLVIMLGSGTALETGILKNVEGFATNTAFFFTDRTGKPFKGFRKGRSWEMHNSDVDVIRKTAQNVQYISPILFGGRAEGNVVYNDRAGAFNVRGVYPDFAKIEQQRFLFGRFINDVDVLHKRKVCVIGTRVYEEFFRKNEDPIGQQIRVKGIYFQIVGVVDGVSGIQIGGRSSETVAVPFSTFQQAYNQGDRVHFLGITARDGTDIEQMEQEVKSILRAQNKIAPDDEQATSSFNVSRMFNMFNSLFLGVRMLVWFVGIGTLLAGIVGVSNIMVVTVRERTREIGVRRALGAKPSKIVVQILTESLLLTSIAGLLGMSVGVGLLSVVDTLLSANPNPDMFFVHPRIDFASAMTASAVLLLSGVMAGIIPTWRALKIKAIDAIREE
Sample Types
Isolate
11.3%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
25.5%
Termitidae
25.5%
Blattidae
17.6%
Unclassified
11.8%
Termopsidae
7.8%
Rhinotermitidae
5.9%
Passalidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 2 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 8 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 9 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 18 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 27 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 28 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 29 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 32 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 38 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 39 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 48 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_126529 | 3300042659 | Bacteria | 36461 |
| 2 | Ga0466690_048468 | 3300042590 | Bacteria | 7092 |
| 3 | Ga0466696_070746 | 3300042596 | Bacteria | 74081 |
| 4 | Ga0466710_359195 | 3300042613 | Unclassified | 1531 |
| 5 | Ga0466718_148809 | 3300042617 | Bacteria | 1754 |
| 6 | Ga0466729_190426 | 3300042621 | Bacteria | 4330 |
| 7 | Ga0466701_095274 | 3300042598 | Bacteria | 10560 |
| 8 | Ga0466701_101814 | 3300042598 | Bacteria | 21696 |
| 9 | Ga0466706_209610 | 3300042599 | Bacteria | 69562 |
| 10 | Ga0466713_004252 | 3300042602 | Bacteria | 4039 |
| 11 | Ga0466713_026669 | 3300042602 | Bacteria | 78730 |
| 12 | Ga0466713_104393 | 3300042602 | Bacteria | 13296 |
| 13 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 14 | Ga0466714_045220 | 3300042603 | Bacteria | 1729 |
| 15 | Ga0466719_024552 | 3300042606 | Bacteria | 3021 |
| 16 | Ga0466722_041850 | 3300042609 | Bacteria | 17417 |
| 17 | JGI24699J35502_11133966 | 3300002509 | Bacteria | 21905 |
| 18 | Ga0466735_021423 | 3300042624 | Bacteria | 2773 |
| 19 | Ga0466703_312847 | 3300042636 | Bacteria | 11553 |
| 20 | Ga0466733_127034 | 3300042659 | Bacteria | 6921 |
| 21 | Ga0466733_201260 | 3300042659 | Bacteria | 4194 |
| 22 | Ga0466696_215596 | 3300042596 | Bacteria | 86390 |
| 23 | Ga0466705_496566 | 3300042612 | Bacteria | 17204 |
| 24 | Ga0123357_10319236 | 3300009784 | Bacteria | 1537 |
| 25 | Ga0466716_443055 | 3300042605 | Bacteria | 5421 |
| 26 | Ga0466708_083149 | 3300042652 | Bacteria | 19271 |
| 27 | Ga0265387_1001428 | 3300024582 | Bacteria | 3501 |
| 28 | Ga0466690_309503 | 3300042590 | Bacteria | 11550 |
| 29 | Ga0466706_046108 | 3300042599 | Bacteria | 5551 |
| 30 | Ga0466706_129722 | 3300042599 | Bacteria | 9634 |
| 31 | Ga0466706_156630 | 3300042599 | Bacteria | 44167 |
| 32 | Ga0466700_019574 | 3300042600 | Bacteria | 4005 |
| 33 | Ga0466714_110748 | 3300042603 | Bacteria | 4141 |
| 34 | Ga0466714_147349 | 3300042603 | Bacteria | 1537 |
| 35 | Ga0466703_070729 | 3300042636 | Bacteria | 4268 |
| 36 | Ga0466733_092492 | 3300042659 | Bacteria | 17976 |
| 37 | Ga0466733_138126 | 3300042659 | Bacteria | 81124 |
| 38 | Ga0466706_071888 | 3300042599 | Bacteria | 2363 |
| 39 | Ga0466707_397960 | 3300042601 | Bacteria | 42331 |
| 40 | Ga0466714_043396 | 3300042603 | Unclassified | 2148 |
| 41 | Ga0466714_127649 | 3300042603 | Bacteria | 1923 |
| 42 | Ga0466719_332744 | 3300042606 | Bacteria | 1572 |
| 43 | Ga0068302_10473739 | 3300005071 | Bacteria | 1354 |
| 44 | Ga0068305_10003924 | 3300005083 | Bacteria | 8624 |
| 45 | Ga0072941_1177329 | 3300005201 | Bacteria | 5496 |
| 46 | Ga0466708_073599 | 3300042652 | Bacteria | 2912 |
| 47 | Ga0466705_263821 | 3300042612 | Bacteria | 21616 |
| 48 | Ga0466690_180311 | 3300042590 | Bacteria | 24767 |
| 49 | Ga0466696_428038 | 3300042596 | Bacteria | 2711 |
| 50 | Ga0466723_062543 | 3300042618 | Bacteria | 7962 |
| 51 | Ga0123353_10226932 | 3300010167 | Unclassified | 2915 |
| 52 | Ga0466701_069369 | 3300042598 | Bacteria | 58155 |
| 53 | Ga0466706_002466 | 3300042599 | Bacteria | 39380 |
| 54 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 55 | Ga0466722_061976 | 3300042609 | Bacteria | 32560 |
| 56 | Ga0466730_084494 | 3300042625 | Bacteria | 3260 |
| 57 | Ga0466709_228070 | 3300042648 | Bacteria | 41532 |
| 58 | Ga0466733_161232 | 3300042659 | Bacteria | 18123 |
| 59 | Ga0466691_159360 | 3300042593 | Bacteria | 14354 |
| 60 | Ga0466715_553683 | 3300042616 | Bacteria | 50351 |
| 61 | Ga0466706_011910 | 3300042599 | Bacteria | 39915 |
| 62 | Ga0466706_014049 | 3300042599 | Bacteria | 54325 |
| 63 | Ga0466707_420009 | 3300042601 | Bacteria | 12228 |
| 64 | Ga0466714_005036 | 3300042603 | Bacteria | 2143 |
| 65 | Ga0466714_126469 | 3300042603 | Bacteria | 66148 |
| 66 | Ga0466714_160623 | 3300042603 | Bacteria | 3153 |
| 67 | Ga0466729_208101 | 3300042621 | Bacteria | 5001 |
| 68 | Ga0466729_260704 | 3300042621 | Bacteria | 2484 |
| 69 | Ga0466735_122595 | 3300042624 | Bacteria | 2238 |
| 70 | Ga0466735_165095 | 3300042624 | Bacteria | 2937 |
| 71 | Ga0466727_101219 | 3300042655 | Bacteria | 84035 |
| 72 | Ga0466705_068425 | 3300042612 | Bacteria | 36245 |
| 73 | Ga0466733_216697 | 3300042659 | Bacteria | 189231 |
| 74 | Ga0466696_002304 | 3300042596 | Bacteria | 6714 |
| 75 | Ga0466712_098182 | 3300042614 | Bacteria | 3322 |
| 76 | Ga0466706_027311 | 3300042599 | Unclassified | 14840 |
| 77 | Ga0466706_119758 | 3300042599 | Bacteria | 63998 |
| 78 | Ga0466713_082115 | 3300042602 | Bacteria | 17794 |
| 79 | Ga0466713_120451 | 3300042602 | Bacteria | 2010 |
| 80 | Ga0466714_110204 | 3300042603 | Bacteria | 1495 |
| 81 | Ga0466714_113742 | 3300042603 | Bacteria | 44490 |
| 82 | Ga0466716_018876 | 3300042605 | Bacteria | 27600 |
| 83 | IMNBL1DRAFT_c0003499 | 3300000062 | Bacteria | 10055 |
| 84 | IMNBL1DRAFT_c0004332 | 3300000062 | Bacteria | 8572 |
| 85 | Ga0466734_036917 | 3300042623 | Bacteria | 1865 |
| 86 | Ga0466735_056956 | 3300042624 | Bacteria | 4165 |
| 87 | Ga0466735_065749 | 3300042624 | Bacteria | 2503 |
| 88 | Ga0466733_149506 | 3300042659 | Bacteria | 259198 |
| 89 | Ga0466723_347679 | 3300042618 | Bacteria | 27958 |
| 90 | Ga0466726_254312 | 3300042619 | Bacteria | 11993 |
| 91 | Ga0466726_493237 | 3300042619 | Bacteria | 10302 |
| 92 | Ga0466728_204608 | 3300042620 | Bacteria | 8173 |
| 93 | Ga0466707_156397 | 3300042601 | Bacteria | 2986 |
| 94 | Ga0466714_084638 | 3300042603 | Bacteria | 4253 |
| 95 | Ga0466719_563524 | 3300042606 | Bacteria | 2164 |
| 96 | Ga0466722_182062 | 3300042609 | Bacteria | 36101 |
| 97 | 2227482972 | 2225789004 | Bacteria | 21758 |
| 98 | JGI24696J40584_12955430 | 3300002834 | Bacteria | 2832 |
| 99 | Ga0466735_046923 | 3300042624 | Bacteria | 1529 |
| 100 | Ga0466735_104997 | 3300042624 | Bacteria | 7260 |
| 101 | Ga0466735_118669 | 3300042624 | Bacteria | 4618 |
| 102 | Ga0466704_448503 | 3300042643 | Bacteria | 16724 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02687 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.