Protein Family IF09243
Metagenome
Isolate
203
Members
101
Samples
153
Scaffolds
265
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_295032|Ga0466703_295032_88_1047
- Length
- 319 aa
- Sequence
- VSGVDSEFKKRQIALKIAQFTSMVGYAKVACHTELGAMLLAFDVGNTNIVLGVFSGDKLIRNWRMETMGSRSADEYGMIINQLFIHEGLNPDDVDDVIISTVVPSMLYTMQHVAYKYFKRRAIVVGPGIKTGLTIKYDNPSQVGADRIVNAVAALSKYGGPLVITDLGTATTFCAVTENWEYLGGTIAPGIKISSEALFEKTAKLPRVELEEPGRTICRTTSESMQAGLVYGHMGMIEFITARMKKELADYAPAKKSVRVIATGGLASMMAGGLDCIDYVDRLLTLEGLHYIYEKNKKFGGDRSVNGDIPLEFVGSIDA
Sample Types
Isolate
24.6%
Metagenome
75.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.5%
Termitidae
21.4%
Apidae
17.3%
Kalotermitidae
12.2%
Blattidae
5.1%
Termopsidae
3.1%
Rhinotermitidae
3.1%
Scarabaeidae
2.0%
Passalidae
2.0%
Euphausiidae
1.0%
Noctuidae
1.0%
Drosophilidae
1.0%
Acrididae
1.0%
Formicidae
1.0%
Armadillidiidae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 2 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 11 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 12 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 13 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 14 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 15 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 18 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 19 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 20 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 21 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 22 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 28 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 29 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 30 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 31 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 32 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 33 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 39 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 44 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 45 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 46 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 47 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 48 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 49 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 57 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 58 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 59 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 60 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 61 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 62 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 63 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 64 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 65 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 66 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 67 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 68 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 69 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 70 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 71 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 72 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 73 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 74 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 75 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 76 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 77 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 78 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 79 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 80 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 81 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 82 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 83 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 84 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 85 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 86 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 87 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 88 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 89 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 90 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 91 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 92 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 93 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 94 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 95 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 96 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 97 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 98 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 99 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 100 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 101 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_194476 | 3300042612 | Bacteria | 7976 |
| 2 | Ga0466732_291502 | 3300042656 | Bacteria | 1353 |
| 3 | Ga0466692_088566 | 3300042591 | Bacteria | 31889 |
| 4 | Ga0466695_339485 | 3300042595 | Bacteria | 6131 |
| 5 | Ga0466696_455039 | 3300042596 | Bacteria | 3047 |
| 6 | Ga0466699_285916 | 3300042597 | Unclassified | 3788 |
| 7 | Ga0123355_10021147 | 3300009826 | Bacteria | 10410 |
| 8 | Ga0123355_10053847 | 3300009826 | Bacteria | 6521 |
| 9 | Ga0123355_10105894 | 3300009826 | Bacteria | 4411 |
| 10 | Ga0123355_10181364 | 3300009826 | Bacteria | 3124 |
| 11 | Ga0123356_10034330 | 3300010049 | Bacteria | 4741 |
| 12 | Ga0123353_10341450 | 3300010167 | Bacteria | 2262 |
| 13 | Ga0466729_226877 | 3300042621 | Bacteria | 14608 |
| 14 | Ga0466703_205733 | 3300042636 | Bacteria | 2279 |
| 15 | Ga0466727_265263 | 3300042655 | Bacteria | 3821 |
| 16 | JGI24703J35330_11730186 | 3300002501 | Bacteria | 2692 |
| 17 | JGI24703J35330_11748102 | 3300002501 | Bacteria | 10690 |
| 18 | JGI24700J35501_10930644 | 3300002508 | Bacteria | 17380 |
| 19 | Ga0466705_464524 | 3300042612 | Bacteria | 24264 |
| 20 | Ga0466723_124386 | 3300042618 | Bacteria | 4104 |
| 21 | Ga0466723_252692 | 3300042618 | Bacteria | 5455 |
| 22 | Ga0466719_049953 | 3300042606 | Bacteria | 2089 |
| 23 | Ga0466722_189243 | 3300042609 | Bacteria | 4605 |
| 24 | Ga0466722_191960 | 3300042609 | Bacteria | 2583 |
| 25 | Ga0466705_346962 | 3300042612 | Unclassified | 2051 |
| 26 | Ga0264413_155810 | 3300024493 | Bacteria | 1553 |
| 27 | Ga0123353_11495486 | 3300010167 | Unclassified | 860 |
| 28 | Ga0466704_413015 | 3300042643 | Unclassified | 8864 |
| 29 | Ga0466724_52627 | 3300042649 | Bacteria | 4618 |
| 30 | Ga0466725_404010 | 3300042654 | Bacteria | 1499 |
| 31 | GhopperDRAF_NODE_226077_len_5680_cov_6_487676 | 2035265001 | Bacteria | 5710 |
| 32 | 2227506582 | 2225789004 | Bacteria | 3657 |
| 33 | JGI24703J35330_11741674 | 3300002501 | Unclassified | 3578 |
| 34 | JGI24703J35330_11745841 | 3300002501 | Bacteria | 4807 |
| 35 | Ga0052191_101393 | 3300003097 | Bacteria | 897 |
| 36 | Ga0068302_10144871 | 3300005071 | Bacteria | 1408 |
| 37 | Ga0072940_1193516 | 3300005200 | Bacteria | 1196 |
| 38 | Ga0072941_1428937 | 3300005201 | Bacteria | 3120 |
| 39 | Ga0466707_071369 | 3300042601 | Bacteria | 5476 |
| 40 | Ga0466707_335454 | 3300042601 | Bacteria | 1966 |
| 41 | Ga0466707_358555 | 3300042601 | Unclassified | 1828 |
| 42 | Ga0123355_10005848 | 3300009826 | Bacteria | 18095 |
| 43 | Ga0123355_10006195 | 3300009826 | Bacteria | 17665 |
| 44 | Ga0123355_10272172 | 3300009826 | Unclassified | 2351 |
| 45 | Ga0123353_10000947 | 3300010167 | Bacteria | 35444 |
| 46 | Ga0123353_10754015 | 3300010167 | Bacteria | 1354 |
| 47 | Ga0466703_179162 | 3300042636 | Bacteria | 1838 |
| 48 | Ga0466703_330405 | 3300042636 | Bacteria | 2337 |
| 49 | Ga0466703_392393 | 3300042636 | Bacteria | 9498 |
| 50 | JGI24698J34947_10000441 | 3300002449 | Bacteria | 19171 |
| 51 | Ga0466705_427457 | 3300042612 | Bacteria | 2166 |
| 52 | Ga0466715_382584 | 3300042616 | Bacteria | 7924 |
| 53 | Ga0466715_489480 | 3300042616 | Bacteria | 20173 |
| 54 | Ga0466718_125900 | 3300042617 | Bacteria | 1741 |
| 55 | Ga0466726_312301 | 3300042619 | Bacteria | 11533 |
| 56 | Ga0466706_131056 | 3300042599 | Bacteria | 8126 |
| 57 | Ga0466707_130896 | 3300042601 | Bacteria | 1613 |
| 58 | Ga0466719_108220 | 3300042606 | Bacteria | 1507 |
| 59 | Ga0466719_559300 | 3300042606 | Bacteria | 2846 |
| 60 | Ga0160445_104238 | 3300012847 | Bacteria | 2663 |
| 61 | Ga0466692_110652 | 3300042591 | Bacteria | 2033 |
| 62 | Ga0466694_196253 | 3300042594 | Bacteria | 1417 |
| 63 | Ga0466699_018689 | 3300042597 | Bacteria | 4237 |
| 64 | Ga0123357_10047938 | 3300009784 | Bacteria | 5790 |
| 65 | Ga0123355_10166677 | 3300009826 | Bacteria | 3304 |
| 66 | Ga0123356_10434712 | 3300010049 | Bacteria | 1457 |
| 67 | Ga0123353_10704586 | 3300010167 | Bacteria | 1416 |
| 68 | Ga0466704_065897 | 3300042643 | Unclassified | 1719 |
| 69 | Ga0466704_230359 | 3300042643 | Bacteria | 1532 |
| 70 | Ga0466708_081130 | 3300042652 | Bacteria | 2259 |
| 71 | HBC_ctgsDRAFT_1068047 | 3300000333 | Unclassified | 852 |
| 72 | JGI24703J35330_11745645 | 3300002501 | Bacteria | 4684 |
| 73 | Ga0466712_016069 | 3300042614 | Bacteria | 20626 |
| 74 | Ga0466718_150604 | 3300042617 | Bacteria | 3053 |
| 75 | Ga0466718_153310 | 3300042617 | Bacteria | 1098 |
| 76 | Ga0466728_012996 | 3300042620 | Bacteria | 4800 |
| 77 | Ga0466707_086327 | 3300042601 | Bacteria | 6722 |
| 78 | Ga0466713_150073 | 3300042602 | Unclassified | 2142 |
| 79 | Ga0466716_219963 | 3300042605 | Bacteria | 6263 |
| 80 | Ga0415639_066081 | 3300038395 | Bacteria | 2418 |
| 81 | Ga0466694_291924 | 3300042594 | Bacteria | 4676 |
| 82 | Ga0466696_037271 | 3300042596 | Bacteria | 7524 |
| 83 | Ga0123355_10000961 | 3300009826 | Bacteria | 39860 |
| 84 | Ga0123355_10043952 | 3300009826 | Bacteria | 7269 |
| 85 | Ga0123353_10016238 | 3300010167 | Bacteria | 10871 |
| 86 | Ga0123353_10452461 | 3300010167 | Bacteria | 1890 |
| 87 | Ga0123353_10557281 | 3300010167 | Bacteria | 1651 |
| 88 | Ga0123353_10763800 | 3300010167 | Bacteria | 1343 |
| 89 | Ga0123353_10939293 | 3300010167 | Bacteria | 1171 |
| 90 | Ga0466702_404331 | 3300042635 | Bacteria | 1047 |
| 91 | Ga0466708_117197 | 3300042652 | Bacteria | 10675 |
| 92 | Ga0466725_031438 | 3300042654 | Bacteria | 22787 |
| 93 | JGI24703J35330_11629648 | 3300002501 | Bacteria | 1490 |
| 94 | JGI24703J35330_11748812 | 3300002501 | Bacteria | 39815 |
| 95 | Ga0072941_1058607 | 3300005201 | Bacteria | 4288 |
| 96 | Ga0466711_480284 | 3300042615 | Bacteria | 2407 |
| 97 | Ga0466715_175834 | 3300042616 | Bacteria | 14492 |
| 98 | Ga0466707_235512 | 3300042601 | Bacteria | 1385 |
| 99 | Ga0466713_023554 | 3300042602 | Bacteria | 27707 |
| 100 | Ga0466713_037580 | 3300042602 | Bacteria | 5758 |
| 101 | Ga0466698_472743 | 3300042610 | Bacteria | 5546 |
| 102 | Ga0466705_239487 | 3300042612 | Bacteria | 2068 |
| 103 | Ga0466692_089751 | 3300042591 | Bacteria | 7005 |
| 104 | Ga0466691_011241 | 3300042593 | Bacteria | 3181 |
| 105 | Ga0466699_130131 | 3300042597 | Unclassified | 3844 |
| 106 | Ga0123355_10095595 | 3300009826 | Bacteria | 4695 |
| 107 | Ga0123353_10024190 | 3300010167 | Bacteria | 9215 |
| 108 | Ga0123353_10827967 | 3300010167 | Bacteria | 1273 |
| 109 | Ga0123354_10157449 | 3300010882 | Bacteria | 2717 |
| 110 | Ga0160465_102546 | 3300012803 | Bacteria | 3912 |
| 111 | Ga0466704_252341 | 3300042643 | Bacteria | 3040 |
| 112 | Ga0466704_541844 | 3300042643 | Bacteria | 1081 |
| 113 | Ga0466727_210985 | 3300042655 | Bacteria | 4296 |
| 114 | IMNBL1DRAFT_c0000157 | 3300000062 | Bacteria | 60406 |
| 115 | IMNBL1DRAFT_c0002519 | 3300000062 | Bacteria | 12689 |
| 116 | JGI24698J34947_10100743 | 3300002449 | Unclassified | 1300 |
| 117 | Ga0072941_1122902 | 3300005201 | Unclassified | 5621 |
| 118 | Ga0466711_355375 | 3300042615 | Bacteria | 1593 |
| 119 | Ga0466723_020008 | 3300042618 | Bacteria | 16859 |
| 120 | Ga0466706_027139 | 3300042599 | Bacteria | 30846 |
| 121 | Ga0466719_065088 | 3300042606 | Bacteria | 4831 |
| 122 | Ga0466722_007097 | 3300042609 | Bacteria | 2422 |
| 123 | Ga0466722_013975 | 3300042609 | Bacteria | 4066 |
| 124 | Ga0466705_311332 | 3300042612 | Bacteria | 101118 |
| 125 | Ga0123355_10043181 | 3300009826 | Bacteria | 7334 |
| 126 | Ga0123355_10193631 | 3300009826 | Bacteria | 2987 |
| 127 | Ga0466704_065041 | 3300042643 | Bacteria | 1823 |
| 128 | Ga0466704_099223 | 3300042643 | Bacteria | 3366 |
| 129 | Ga0466708_019840 | 3300042652 | Bacteria | 10358 |
| 130 | Ga0466708_037286 | 3300042652 | Bacteria | 15511 |
| 131 | Ga0466727_075247 | 3300042655 | Bacteria | 1950 |
| 132 | 2227209701 | 2225789004 | Bacteria | 1417 |
| 133 | 2227240255 | 2225789004 | Bacteria | 1343 |
| 134 | IMNBL1DRAFT_c0002131 | 3300000062 | Bacteria | 14059 |
| 135 | Ga0072941_1752284 | 3300005201 | Bacteria | 1045 |
| 136 | Ga0074278_140947 | 3300005721 | Bacteria | 3764 |
| 137 | Ga0466707_086791 | 3300042601 | Bacteria | 10828 |
| 138 | Ga0466705_239180 | 3300042612 | Bacteria | 18595 |
| 139 | Ga0466691_028455 | 3300042593 | Bacteria | 6899 |
| 140 | Ga0123355_10346138 | 3300009826 | Bacteria | 1975 |
| 141 | Ga0123356_10016455 | 3300010049 | Bacteria | 7054 |
| 142 | Ga0123353_10177827 | 3300010167 | Bacteria | 3372 |
| 143 | Ga0466703_295032 | 3300042636 | Bacteria | 5538 |
| 144 | Ga0466725_005389 | 3300042654 | Bacteria | 23741 |
| 145 | HBC_ctgsDRAFT_1003702 | 3300000333 | Bacteria | 3511 |
| 146 | JGI24703J35330_11748801 | 3300002501 | Bacteria | 37596 |
| 147 | Ga0466715_206418 | 3300042616 | Bacteria | 2202 |
| 148 | Ga0466718_158150 | 3300042617 | Bacteria | 1898 |
| 149 | Ga0466728_198759 | 3300042620 | Bacteria | 1888 |
| 150 | Ga0466707_207190 | 3300042601 | Bacteria | 21443 |
| 151 | Ga0466707_405890 | 3300042601 | Bacteria | 39803 |
| 152 | Ga0466713_054184 | 3300042602 | Bacteria | 9309 |
| 153 | Ga0466719_280179 | 3300042606 | Bacteria | 3503 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03309 | Pan_kinase | Type III pantothenate kinase | 39 | 242 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03309 | GO:0004594 | pantothenate kinase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.