Protein Family IF09229

Metagenome Isolate
238 Members
66 Samples
218 Scaffolds
534.11 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_273461|Ga0466703_273461_7526_9412
Length
628 aa
Sequence
MHGVNQAQPFFNSRPGKNGFHFAGDVDKFFWFFCIEPQFFNGRFHAGKCITQAVSEKPFTAGFCFEVSRPRRVIFSKKAKLGILSVKEYMGDLQTTVKNLHPLEVKIILHYKKGEELTIEKVESDLELKGGNGNQALSWLAGKGIVSELRRETNVYFELTDLGREWQKKGTPEERILEYVRIKPGEKMPGIAEAIKLENKDIGSAFGALSKLGVLALDSGKGVVMALPSDSLVNGRPAAGPGAEHFAVIRGLLEKAAGPGGALLAGSLLDEKEKEAMRGMAKKRAAADAPFREIDRETVVFGFAGSTAETGRDALAAALEAAGITGEETGALTPEMLAAGSWRGKAFRSYNIKVPPTRLIPGRTNPYAKFLEDVKDKLASLGFEEFDGPLVETEFWNSDALFMPQFHSARDIHDVYRVAGKGGETAHALSIEEPWLSNVAAAHDSGGKTGSRGWSYKFDREFTRRLVLRSQGTVLSAKTLPRAKIPGKYFGIVRCFRYDRVDATHLPDFYQTEGIVLGEDVNLKTLLGMLEMFAMEVAGAKEVKYVPGYFPFTEPSVEVHIKHPVLGWFELGGSGIFRPEVTESLGITVPVAAWGIGIDRMALMALGLNDLRELFSYDIESVRLRRTK

📊 Sample Types

Isolate 8.4%
Metagenome 91.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.8%
Termitidae 32.3%
Kalotermitidae 23.1%
Rhinotermitidae 4.6%
Termopsidae 4.6%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 230
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
14 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
23 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
24 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
25 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
26 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
29 650716102 Treponema primitia ZAS-2 Isolate Unclassified
30 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
31 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
32 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
33 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
41 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
42 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
43 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
48 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
49 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
50 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
51 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
53 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
54 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
55 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
56 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
57 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
58 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
59 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
60 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
61 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
62 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
63 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_063130 3300042614 Bacteria 19551
2 Ga0466711_032837 3300042615 Bacteria 14626
3 Ga0466718_126963 3300042617 Bacteria 21562
4 Ga0466723_050209 3300042618 Bacteria 13281
5 Ga0466723_184906 3300042618 Bacteria 2061
6 2230954230 2228664003 Bacteria 8827
7 JGI24698J34947_10000453 3300002449 Bacteria 19048
8 JGI24698J34947_10051444 3300002449 Bacteria 2071
9 JGI24695J34938_10000230 3300002450 Bacteria 53061
10 JGI24695J34938_10001500 3300002450 Bacteria 19706
11 JGI24695J34938_10002788 3300002450 Bacteria 12813
12 Ga0123355_10012393 3300009826 Bacteria 13205
13 Ga0123353_10001701 3300010167 Bacteria 27024
14 Ga0123353_10003194 3300010167 Bacteria 20632
15 Ga0466735_085356 3300042624 Bacteria 6976
16 Ga0466703_098710 3300042636 Bacteria 5433
17 Ga0466703_179403 3300042636 Bacteria 16793
18 Ga0466703_371085 3300042636 Bacteria 3827
19 Ga0466704_310791 3300042643 Bacteria 2757
20 Ga0466708_179204 3300042652 Bacteria 8636
21 Ga0466727_032965 3300042655 Bacteria 22745
22 Ga0466690_259737 3300042590 Bacteria 21195
23 Ga0466692_021193 3300042591 Bacteria 22153
24 Ga0466692_187212 3300042591 Bacteria 19890
25 Ga0466691_044701 3300042593 Bacteria 40808
26 Ga0466696_087964 3300042596 Bacteria 10591
27 Ga0466706_112524 3300042599 Bacteria 2448
28 Ga0466716_072807 3300042605 Bacteria 11205
29 Ga0466720_042648 3300042607 Bacteria 13564
30 Ga0466722_106741 3300042609 Bacteria 11675
31 Ga0466722_190160 3300042609 Bacteria 2342
32 Ga0466712_006157 3300042614 Bacteria 4283
33 Ga0466712_315124 3300042614 Bacteria 3955
34 Ga0466715_050591 3300042616 Bacteria 8335
35 Ga0466715_198662 3300042616 Bacteria 2177
36 Ga0466718_089779 3300042617 Bacteria 9773
37 Ga0466723_054549 3300042618 Bacteria 5383
38 Ga0466723_275904 3300042618 Bacteria 2592
39 Ga0466726_077891 3300042619 Unclassified 4196
40 JGI24695J34938_10001663 3300002450 Bacteria 18477
41 JGI24695J34938_10003516 3300002450 Bacteria 10871
42 Ga0123357_10033435 3300009784 Bacteria 6987
43 Ga0466704_041778 3300042643 Bacteria 21856
44 Ga0466704_323534 3300042643 Bacteria 49468
45 Ga0466727_008034 3300042655 Bacteria 4330
46 Ga0466690_041596 3300042590 Bacteria 8110
47 Ga0466690_321497 3300042590 Bacteria 11781
48 Ga0466691_115283 3300042593 Bacteria 22958
49 Ga0466691_149078 3300042593 Bacteria 2761
50 Ga0466696_202044 3300042596 Bacteria 7031
51 Ga0466706_140575 3300042599 Bacteria 24722
52 Ga0466707_135503 3300042601 Bacteria 11840
53 Ga0466716_002857 3300042605 Bacteria 6949
54 Ga0466719_091036 3300042606 Bacteria 23966
55 Ga0466719_364525 3300042606 Bacteria 3788
56 Ga0466720_098321 3300042607 Bacteria 5312
57 Ga0466722_191502 3300042609 Bacteria 4612
58 Ga0466711_108591 3300042615 Bacteria 5174
59 Ga0466711_324246 3300042615 Bacteria 2329
60 Ga0466711_382504 3300042615 Bacteria 5903
61 Ga0466715_121180 3300042616 Bacteria 3361
62 Ga0466726_194636 3300042619 Bacteria 1809
63 Ga0466726_345190 3300042619 Bacteria 3720
64 JGI24698J34947_10014135 3300002449 Bacteria 4348
65 JGI24695J34938_10000061 3300002450 Bacteria 88663
66 JGI24695J34938_10001097 3300002450 Bacteria 24425
67 JGI24700J35501_10929815 3300002508 Bacteria 10278
68 Ga0123356_10004566 3300010049 Bacteria 14269
69 Ga0123353_10105221 3300010167 Bacteria 4547
70 Ga0466705_252522 3300042612 Bacteria 17303
71 Ga0466705_283476 3300042612 Bacteria 3265
72 Ga0466703_112591 3300042636 Bacteria 8328
73 Ga0466704_108966 3300042643 Bacteria 5948
74 Ga0466708_128469 3300042652 Bacteria 2711
75 Ga0466727_049203 3300042655 Bacteria 1837
76 Ga0264413_101273 3300024493 Unclassified 3162
77 Ga0466690_322833 3300042590 Bacteria 5294
78 Ga0466694_108981 3300042594 Bacteria 10264
79 Ga0466694_190140 3300042594 Bacteria 15940
80 Ga0466694_212684 3300042594 Bacteria 33118
81 Ga0466713_135204 3300042602 Bacteria 16943
82 Ga0466716_317010 3300042605 Bacteria 10524
83 Ga0466720_013283 3300042607 Bacteria 21582
84 Ga0466720_047085 3300042607 Bacteria 2480
85 Ga0466720_134404 3300042607 Bacteria 17496
86 Ga0466712_028099 3300042614 Bacteria 19926
87 Ga0466712_154433 3300042614 Bacteria 1922
88 Ga0466711_493292 3300042615 Bacteria 6541
89 Ga0466726_171821 3300042619 Bacteria 5861
90 AustNasuHG_c1001445 3300000089 Bacteria 8516
91 Ga0123356_10005275 3300010049 Bacteria 13195
92 Ga0123353_10195929 3300010167 Bacteria 3184
93 Ga0123353_10297944 3300010167 Bacteria 2464
94 Ga0466705_035196 3300042612 Bacteria 3955
95 Ga0466703_051255 3300042636 Bacteria 36806
96 Ga0466704_095529 3300042643 Bacteria 2118
97 Ga0466709_043256 3300042648 Bacteria 8734
98 Ga0466727_258724 3300042655 Bacteria 5130
99 Ga0466690_283334 3300042590 Bacteria 3454
100 Ga0466691_010686 3300042593 Bacteria 3132
101 Ga0466691_065346 3300042593 Bacteria 5604
102 Ga0466694_042400 3300042594 Bacteria 28566
103 Ga0466700_162524 3300042600 Bacteria 6142
104 Ga0466707_289093 3300042601 Bacteria 2811
105 Ga0466716_052623 3300042605 Bacteria 16164
106 Ga0466716_529110 3300042605 Bacteria 10423
107 Ga0466719_029555 3300042606 Bacteria 4480
108 Ga0466720_025850 3300042607 Bacteria 2624
109 Ga0466722_009054 3300042609 Bacteria 7982
110 Ga0466732_433114 3300042656 Bacteria 3418
111 Ga0466712_001441 3300042614 Bacteria 29253
112 Ga0466712_079378 3300042614 Bacteria 31085
113 Ga0466715_009607 3300042616 Bacteria 4074
114 Ga0466718_021472 3300042617 Bacteria 4064
115 Ga0466718_030345 3300042617 Bacteria 12149
116 Ga0466718_043660 3300042617 Bacteria 5839
117 Ga0466723_046485 3300042618 Bacteria 17341
118 Ga0466723_050228 3300042618 Bacteria 4598
119 Ga0466726_445476 3300042619 Bacteria 4643
120 Ga0068305_10933461 3300005083 Bacteria 2278
121 Ga0123356_10000245 3300010049 Bacteria 62546
122 Ga0466705_066571 3300042612 Bacteria 4351
123 Ga0466731_096707 3300042622 Bacteria 2016
124 Ga0466734_028817 3300042623 Bacteria 3792
125 Ga0466704_020550 3300042643 Bacteria 20715
126 Ga0466704_580379 3300042643 Bacteria 21505
127 Ga0466708_106281 3300042652 Bacteria 7500
128 Ga0466727_337313 3300042655 Bacteria 2071
129 Ga0466692_079917 3300042591 Bacteria 13056
130 Ga0466691_180662 3300042593 Bacteria 16009
131 Ga0466691_195447 3300042593 Bacteria 18449
132 Ga0466694_261492 3300042594 Bacteria 26912
133 Ga0466719_201342 3300042606 Bacteria 38826
134 Ga0466719_231065 3300042606 Bacteria 1939
135 Ga0466719_353167 3300042606 Bacteria 93798
136 Ga0466705_408244 3300042612 Bacteria 3288
137 Ga0466711_083367 3300042615 Bacteria 13215
138 Ga0466715_602133 3300042616 Bacteria 2810
139 Ga0466723_129172 3300042618 Bacteria 33143
140 JGI24695J34938_10000003 3300002450 Bacteria 167365
141 JGI24695J34938_10000397 3300002450 Bacteria 42671
142 JGI24695J34938_10000570 3300002450 Bacteria 35481
143 Ga0123357_10000270 3300009784 Bacteria 49669
144 Ga0123353_10012462 3300010167 Bacteria 12090
145 Ga0123354_10005739 3300010882 Unclassified 18169
146 Ga0466705_103996 3300042612 Bacteria 11092
147 Ga0466705_211823 3300042612 Bacteria 7474
148 Ga0466705_288735 3300042612 Bacteria 3257
149 Ga0466703_154423 3300042636 Bacteria 4659
150 Ga0466703_273461 3300042636 Bacteria 30310
151 Ga0466704_304480 3300042643 Bacteria 25615
152 Ga0466704_492939 3300042643 Bacteria 1938
153 Ga0466709_107477 3300042648 Bacteria 18954
154 Ga0466708_364059 3300042652 Bacteria 5832
155 Ga0466727_066942 3300042655 Bacteria 35986
156 Ga0466691_004379 3300042593 Bacteria 27826
157 Ga0466691_074649 3300042593 Bacteria 10389
158 Ga0466691_144940 3300042593 Bacteria 4872
159 Ga0466691_193098 3300042593 Bacteria 6454
160 Ga0466695_256402 3300042595 Bacteria 12029
161 Ga0466716_242259 3300042605 Bacteria 6409
162 Ga0466719_337566 3300042606 Bacteria 7457
163 Ga0466722_044551 3300042609 Bacteria 5227
164 Ga0466722_166798 3300042609 Bacteria 17023
165 Ga0466712_007403 3300042614 Bacteria 5207
166 Ga0466712_025419 3300042614 Bacteria 13265
167 Ga0466711_411375 3300042615 Bacteria 19214
168 Ga0466723_112219 3300042618 Bacteria 2785
169 Ga0466726_214887 3300042619 Bacteria 3553
170 Ga0466728_092586 3300042620 Bacteria 8257
171 Ga0466728_211929 3300042620 Bacteria 3736
172 JGI24695J34938_10000092 3300002450 Bacteria 78528
173 JGI24695J34938_10000820 3300002450 Bacteria 28898
174 JGI24695J34938_10001180 3300002450 Bacteria 23232
175 JGI24697J35500_11274271 3300002507 Bacteria 6870
176 Ga0466703_075407 3300042636 Bacteria 3127
177 Ga0466704_094872 3300042643 Unclassified 2231
178 Ga0466708_123018 3300042652 Bacteria 5272
179 Ga0466708_207873 3300042652 Bacteria 4196
180 Ga0456237_0000709 3300041968 Bacteria 5116
181 Ga0466690_123946 3300042590 Bacteria 2584
182 Ga0466692_077671 3300042591 Bacteria 4271
183 Ga0466691_107456 3300042593 Bacteria 4577
184 Ga0466707_143223 3300042601 Bacteria 2052
185 Ga0466716_108318 3300042605 Bacteria 4539
186 Ga0466719_282348 3300042606 Unclassified 19679
187 Ga0466720_022564 3300042607 Bacteria 3815
188 Ga0466720_053259 3300042607 Bacteria 9108
189 Ga0466722_053695 3300042609 Bacteria 7052
190 Ga0466732_204583 3300042656 Bacteria 3216
191 Ga0466712_017384 3300042614 Bacteria 39634
192 Ga0466711_202837 3300042615 Bacteria 6335
193 Ga0466711_237308 3300042615 Bacteria 28785
194 Ga0466715_048220 3300042616 Bacteria 10924
195 Ga0466715_246542 3300042616 Unclassified 11010
196 Ga0466723_243195 3300042618 Bacteria 87629
197 Ga0466723_264219 3300042618 Bacteria 3756
198 Ga0466726_260039 3300042619 Bacteria 2339
199 JGI24698J34947_10026767 3300002449 Bacteria 3062
200 JGI24698J34947_10026772 3300002449 Bacteria 3062
201 JGI24695J34938_10003856 3300002450 Bacteria 10164
202 Ga0123356_10008606 3300010049 Bacteria 10124
203 Ga0466705_188602 3300042612 Bacteria 4441
204 Ga0466703_028992 3300042636 Bacteria 5922
205 Ga0466703_032733 3300042636 Bacteria 48215
206 Ga0466704_158625 3300042643 Unclassified 5944
207 Ga0466704_176137 3300042643 Bacteria 10175
208 Ga0466704_555629 3300042643 Unclassified 7997
209 Ga0466708_081635 3300042652 Bacteria 63753
210 Ga0466708_256998 3300042652 Bacteria 2368
211 Ga0466692_036145 3300042591 Bacteria 11192
212 Ga0466691_163050 3300042593 Bacteria 5590
213 Ga0466694_037716 3300042594 Bacteria 41676
214 Ga0466696_149927 3300042596 Bacteria 33912
215 Ga0466699_220689 3300042597 Bacteria 48448
216 Ga0466719_253043 3300042606 Bacteria 2094
217 Ga0466719_258640 3300042606 Bacteria 2601
218 Ga0466719_453172 3300042606 Bacteria 8616

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F) 350 622 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.