Protein Family IF09227
Metagenome
Isolate
107
Members
42
Samples
104
Scaffolds
162.09
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_268002|Ga0466703_268002_4426_5031
- Length
- 195 aa
- Sequence
- MLRIGLGRDLHRLGEGRRFVLGGVEIPSEKGEIGHSDGDVLIHAEIDALLGASGLGDIGSFFPSADSQWKDAPSLRLLGIIWDTLRGEDWSIVNIDCVVSCEKPAVLPHREKIRETLGAALGIGAGRIFLKGKTGEGIGCIGRGEAVEAIAVCLLEKDDKRGRPGDGRNRISHGQPETSGAAKKSFFFRSPGIKR
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.5%
Kalotermitidae
31.0%
Termopsidae
9.5%
Rhinotermitidae
7.1%
Unclassified
4.8%
Hodotermitidae
2.4%
Aphididae
2.4%
Passalidae
2.4%
Taxonomy
Archaea
0
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 13 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 14 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 28 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_029109 | 3300042659 | Bacteria | 2584 |
| 2 | Ga0123355_10020640 | 3300009826 | Bacteria | 10527 |
| 3 | Ga0123355_10317975 | 3300009826 | Bacteria | 2101 |
| 4 | Ga0123353_10066483 | 3300010167 | Bacteria | 5786 |
| 5 | Ga0123353_11407755 | 3300010167 | Bacteria | 896 |
| 6 | Ga0466706_049449 | 3300042599 | Bacteria | 2859 |
| 7 | Ga0466706_077154 | 3300042599 | Bacteria | 4979 |
| 8 | Ga0466714_141997 | 3300042603 | Bacteria | 2326 |
| 9 | Ga0466717_187425 | 3300042604 | Bacteria | 4147 |
| 10 | Ga0466716_124796 | 3300042605 | Bacteria | 18923 |
| 11 | Ga0466719_095083 | 3300042606 | Bacteria | 2503 |
| 12 | Ga0466703_051636 | 3300042636 | Bacteria | 6322 |
| 13 | Ga0466704_478157 | 3300042643 | Bacteria | 2834 |
| 14 | Ga0466708_289194 | 3300042652 | Bacteria | 1845 |
| 15 | Ga0466727_022528 | 3300042655 | Bacteria | 3032 |
| 16 | Ga0466711_095183 | 3300042615 | Bacteria | 2337 |
| 17 | Ga0466711_463897 | 3300042615 | Bacteria | 1825 |
| 18 | Ga0466715_051442 | 3300042616 | Bacteria | 1604 |
| 19 | Ga0466715_095992 | 3300042616 | Bacteria | 6088 |
| 20 | Ga0466715_260067 | 3300042616 | Bacteria | 89805 |
| 21 | Ga0466715_557279 | 3300042616 | Bacteria | 2080 |
| 22 | Ga0466696_215861 | 3300042596 | Bacteria | 1567 |
| 23 | Ga0123353_10418458 | 3300010167 | Bacteria | 1987 |
| 24 | Ga0123353_11288608 | 3300010167 | Bacteria | 950 |
| 25 | Ga0466706_272303 | 3300042599 | Bacteria | 1238 |
| 26 | Ga0466700_190562 | 3300042600 | Bacteria | 4170 |
| 27 | Ga0466719_113878 | 3300042606 | Bacteria | 3243 |
| 28 | Ga0466698_496092 | 3300042610 | Bacteria | 1790 |
| 29 | Ga0466734_074875 | 3300042623 | Bacteria | 1168 |
| 30 | Ga0466703_039149 | 3300042636 | Bacteria | 15565 |
| 31 | Ga0466703_302657 | 3300042636 | Bacteria | 56159 |
| 32 | Ga0068302_10203202 | 3300005071 | Bacteria | 1214 |
| 33 | Ga0466711_349834 | 3300042615 | Bacteria | 1856 |
| 34 | Ga0466715_479803 | 3300042616 | Bacteria | 2139 |
| 35 | Ga0466715_507023 | 3300042616 | Bacteria | 3076 |
| 36 | Ga0466723_155882 | 3300042618 | Bacteria | 7871 |
| 37 | Ga0466690_117708 | 3300042590 | Bacteria | 29326 |
| 38 | Ga0466692_018965 | 3300042591 | Bacteria | 10438 |
| 39 | Ga0466691_007403 | 3300042593 | Bacteria | 2706 |
| 40 | Ga0466691_011096 | 3300042593 | Bacteria | 18766 |
| 41 | Ga0123355_11445880 | 3300009826 | Bacteria | 675 |
| 42 | Ga0123356_10245611 | 3300010049 | Bacteria | 1864 |
| 43 | Ga0123353_10698585 | 3300010167 | Bacteria | 1424 |
| 44 | Ga0466722_101547 | 3300042609 | Bacteria | 8702 |
| 45 | Ga0466698_063434 | 3300042610 | Bacteria | 3940 |
| 46 | Ga0466731_175424 | 3300042622 | Bacteria | 1064 |
| 47 | Ga0466727_329082 | 3300042655 | Bacteria | 13032 |
| 48 | Ga0466726_101410 | 3300042619 | Bacteria | 18973 |
| 49 | Ga0466690_088000 | 3300042590 | Bacteria | 2427 |
| 50 | Ga0466694_072391 | 3300042594 | Bacteria | 21915 |
| 51 | Ga0123353_10033878 | 3300010167 | Bacteria | 7960 |
| 52 | Ga0123353_11390563 | 3300010167 | Bacteria | 903 |
| 53 | Ga0466719_012647 | 3300042606 | Bacteria | 1428 |
| 54 | Ga0466721_063185 | 3300042608 | Bacteria | 1092 |
| 55 | Ga0466722_033353 | 3300042609 | Bacteria | 6302 |
| 56 | Ga0466703_268002 | 3300042636 | Bacteria | 7540 |
| 57 | Ga0466704_093114 | 3300042643 | Bacteria | 3497 |
| 58 | Ga0466715_223833 | 3300042616 | Bacteria | 4825 |
| 59 | Ga0466729_030073 | 3300042621 | Bacteria | 4150 |
| 60 | Ga0415639_005208 | 3300038395 | Bacteria | 17001 |
| 61 | Ga0415639_018755 | 3300038395 | Bacteria | 31667 |
| 62 | Ga0466705_327960 | 3300042612 | Bacteria | 1555 |
| 63 | Ga0123354_10453911 | 3300010882 | Bacteria | 1036 |
| 64 | Ga0466731_037389 | 3300042622 | Bacteria | 1504 |
| 65 | Ga0466704_294163 | 3300042643 | Bacteria | 4088 |
| 66 | JGI24702J35022_10082192 | 3300002462 | Unclassified | 1746 |
| 67 | Ga0466715_203150 | 3300042616 | Bacteria | 4627 |
| 68 | Ga0466718_093128 | 3300042617 | Bacteria | 2978 |
| 69 | Ga0466723_090407 | 3300042618 | Bacteria | 3081 |
| 70 | Ga0466726_111867 | 3300042619 | Bacteria | 10173 |
| 71 | Ga0466726_179807 | 3300042619 | Bacteria | 5017 |
| 72 | Ga0466696_256433 | 3300042596 | Bacteria | 3928 |
| 73 | Ga0123353_11894645 | 3300010167 | Bacteria | 736 |
| 74 | Ga0466706_055330 | 3300042599 | Bacteria | 1005 |
| 75 | Ga0466720_137964 | 3300042607 | Bacteria | 1257 |
| 76 | Ga0466703_024071 | 3300042636 | Bacteria | 5990 |
| 77 | Ga0466704_214339 | 3300042643 | Bacteria | 3219 |
| 78 | Ga0466715_059755 | 3300042616 | Bacteria | 8416 |
| 79 | Ga0466718_101327 | 3300042617 | Bacteria | 1167 |
| 80 | Ga0466723_013675 | 3300042618 | Bacteria | 13164 |
| 81 | Ga0466726_173921 | 3300042619 | Bacteria | 2185 |
| 82 | Ga0466690_253731 | 3300042590 | Bacteria | 9496 |
| 83 | Ga0466696_276396 | 3300042596 | Bacteria | 11267 |
| 84 | Ga0466705_257110 | 3300042612 | Bacteria | 5294 |
| 85 | Ga0466717_189193 | 3300042604 | Bacteria | 5205 |
| 86 | Ga0466719_404328 | 3300042606 | Bacteria | 11399 |
| 87 | Ga0466735_013321 | 3300042624 | Bacteria | 1912 |
| 88 | Ga0466709_084227 | 3300042648 | Bacteria | 3124 |
| 89 | IMNBL1DRAFT_c0000556 | 3300000062 | Bacteria | 30324 |
| 90 | Ga0466726_182421 | 3300042619 | Bacteria | 1710 |
| 91 | Ga0466726_479977 | 3300042619 | Bacteria | 5542 |
| 92 | Ga0466692_071110 | 3300042591 | Bacteria | 106079 |
| 93 | Ga0466696_339956 | 3300042596 | Bacteria | 2805 |
| 94 | Ga0123355_10057683 | 3300009826 | Bacteria | 6283 |
| 95 | Ga0123353_10634350 | 3300010167 | Bacteria | 1517 |
| 96 | Ga0123353_11085414 | 3300010167 | Bacteria | 1065 |
| 97 | Ga0466722_265957 | 3300042609 | Bacteria | 7778 |
| 98 | Ga0466703_213677 | 3300042636 | Bacteria | 10192 |
| 99 | Ga0466727_327722 | 3300042655 | Bacteria | 1815 |
| 100 | Ga0466715_409166 | 3300042616 | Unclassified | 3449 |
| 101 | Ga0415639_132227 | 3300038395 | Bacteria | 1274 |
| 102 | Ga0466691_027556 | 3300042593 | Bacteria | 12619 |
| 103 | Ga0466691_163904 | 3300042593 | Bacteria | 1393 |
| 104 | Ga0466694_194453 | 3300042594 | Bacteria | 16387 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042593 | Ga0466691_011096 | Ga0466691_011096_1028_1450 | 140 |
| 2 | 3300042594 | Ga0466694_072391 | Ga0466694_072391_18586_19056 | 156 |
| 3 | 3300042604 | Ga0466717_189193 | Ga0466717_189193_3135_3605 | 156 |
| 4 | 3300042606 | Ga0466719_404328 | Ga0466719_404328_3418_3891 | 157 |
| 5 | 3300042615 | Ga0466711_463897 | Ga0466711_463897_889_1362 | 157 |
| 6 | 3300042616 | Ga0466715_203150 | Ga0466715_203150_1764_2264 | 157 |
| 7 | 3300042619 | Ga0466726_179807 | Ga0466726_179807_330_803 | 157 |
| 8 | 3300042619 | Ga0466726_182421 | Ga0466726_182421_979_1452 | 157 |
| 9 | 3300042619 | Ga0466726_479977 | Ga0466726_479977_1244_1717 | 157 |
| 10 | 3300042623 | Ga0466734_074875 | Ga0466734_074875_420_893 | 157 |
| 11 | 3300042636 | Ga0466703_024071 | Ga0466703_024071_1804_2277 | 157 |
| 12 | 3300042655 | Ga0466727_327722 | Ga0466727_327722_205_678 | 157 |
| 13 | iso_pr_bacteria | 2984883310 | 2984883790 | 157 |
| 14 | 3300005071 | Ga0068302_10203202 | Ga0068302_102032021 | 158 |
| 15 | 3300009826 | Ga0123355_10057683 | Ga0123355_100576837 | 158 |
| 16 | 3300010167 | Ga0123353_11288608 | Ga0123353_112886082 | 158 |
| 17 | 3300038395 | Ga0415639_132227 | Ga0415639_132227_402_878 | 158 |
| 18 | 3300042593 | Ga0466691_027556 | Ga0466691_027556_11867_12343 | 158 |
| 19 | 3300042594 | Ga0466694_194453 | Ga0466694_194453_7090_7566 | 158 |
| 20 | 3300042606 | Ga0466719_095083 | Ga0466719_095083_274_750 | 158 |
| 21 | 3300042606 | Ga0466719_113878 | Ga0466719_113878_1121_1597 | 158 |
| 22 | 3300042607 | Ga0466720_137964 | Ga0466720_137964_302_778 | 158 |
| 23 | 3300042610 | Ga0466698_063434 | Ga0466698_063434_1005_1481 | 158 |
| 24 | 3300042610 | Ga0466698_496092 | Ga0466698_496092_1219_1695 | 158 |
| 25 | 3300042615 | Ga0466711_095183 | Ga0466711_095183_1082_1558 | 158 |
| 26 | 3300042615 | Ga0466711_349834 | Ga0466711_349834_1053_1529 | 158 |
| 27 | 3300042616 | Ga0466715_223833 | Ga0466715_223833_3597_4073 | 158 |
| 28 | 3300042616 | Ga0466715_260067 | Ga0466715_260067_31901_32377 | 158 |
| 29 | 3300042622 | Ga0466731_037389 | Ga0466731_037389_839_1315 | 158 |
| 30 | 3300042622 | Ga0466731_175424 | Ga0466731_175424_64_540 | 158 |
| 31 | 3300042636 | Ga0466703_302657 | Ga0466703_302657_23106_23582 | 158 |
| 32 | 3300042648 | Ga0466709_084227 | Ga0466709_084227_1940_2416 | 158 |
| 33 | 3300042659 | Ga0466733_029109 | Ga0466733_029109_1630_2106 | 158 |
| 34 | 3300000062 | IMNBL1DRAFT_c0000556 | IMNBL1DRAFT_000055623 | 159 |
| 35 | 3300009826 | Ga0123355_10317975 | Ga0123355_103179753 | 159 |
| 36 | 3300010167 | Ga0123353_11085414 | Ga0123353_110854142 | 159 |
| 37 | 3300010167 | Ga0123353_11894645 | Ga0123353_118946451 | 159 |
| 38 | 3300010882 | Ga0123354_10453911 | Ga0123354_104539112 | 159 |
| 39 | 3300042590 | Ga0466690_088000 | Ga0466690_088000_103_582 | 159 |
| 40 | 3300042590 | Ga0466690_253731 | Ga0466690_253731_2959_3438 | 159 |
| 41 | 3300042591 | Ga0466692_071110 | Ga0466692_071110_62213_62692 | 159 |
| 42 | 3300042599 | Ga0466706_077154 | Ga0466706_077154_2631_3110 | 159 |
| 43 | 3300042612 | Ga0466705_327960 | Ga0466705_327960_836_1315 | 159 |
| 44 | 3300042616 | Ga0466715_409166 | Ga0466715_409166_507_986 | 159 |
| 45 | 3300042617 | Ga0466718_101327 | Ga0466718_101327_48_527 | 159 |
| 46 | 3300042618 | Ga0466723_013675 | Ga0466723_013675_152_631 | 159 |
| 47 | 3300042618 | Ga0466723_155882 | Ga0466723_155882_3964_4443 | 159 |
| 48 | 3300042624 | Ga0466735_013321 | Ga0466735_013321_32_511 | 159 |
| 49 | 3300042636 | Ga0466703_213677 | Ga0466703_213677_4600_5079 | 159 |
| 50 | 3300042643 | Ga0466704_214339 | Ga0466704_214339_1644_2123 | 159 |
| 51 | 3300010167 | Ga0123353_10066483 | Ga0123353_100664838 | 160 |
| 52 | 3300010167 | Ga0123353_10418458 | Ga0123353_104184582 | 160 |
| 53 | 3300010167 | Ga0123353_10698585 | Ga0123353_106985852 | 160 |
| 54 | 3300010167 | Ga0123353_11407755 | Ga0123353_114077551 | 160 |
| 55 | 3300042596 | Ga0466696_276396 | Ga0466696_276396_4334_4816 | 160 |
| 56 | 3300042609 | Ga0466722_033353 | Ga0466722_033353_5338_5820 | 160 |
| 57 | 3300042636 | Ga0466703_051636 | Ga0466703_051636_824_1306 | 160 |
| 58 | 3300042643 | Ga0466704_093114 | Ga0466704_093114_2533_3015 | 160 |
| 59 | 3300042652 | Ga0466708_289194 | Ga0466708_289194_623_1105 | 160 |
| 60 | 3300009826 | Ga0123355_11445880 | Ga0123355_114458801 | 161 |
| 61 | 3300010049 | Ga0123356_10245611 | Ga0123356_102456112 | 161 |
| 62 | 3300038395 | Ga0415639_018755 | Ga0415639_018755_18618_19103 | 161 |
| 63 | 3300042593 | Ga0466691_163904 | Ga0466691_163904_451_954 | 161 |
| 64 | 3300042599 | Ga0466706_049449 | Ga0466706_049449_2068_2553 | 161 |
| 65 | 3300042599 | Ga0466706_272303 | Ga0466706_272303_238_723 | 161 |
| 66 | 3300042600 | Ga0466700_190562 | Ga0466700_190562_2457_2942 | 161 |
| 67 | 3300042609 | Ga0466722_101547 | Ga0466722_101547_2257_2742 | 161 |
| 68 | 3300042619 | Ga0466726_111867 | Ga0466726_111867_4377_4862 | 161 |
| 69 | 3300042643 | Ga0466704_294163 | Ga0466704_294163_3401_3886 | 161 |
| 70 | 3300042591 | Ga0466692_018965 | Ga0466692_018965_6442_6930 | 162 |
| 71 | 3300042605 | Ga0466716_124796 | Ga0466716_124796_407_895 | 162 |
| 72 | 3300042616 | Ga0466715_507023 | Ga0466715_507023_1453_1941 | 162 |
| 73 | 3300042618 | Ga0466723_090407 | Ga0466723_090407_1647_2135 | 162 |
| 74 | 3300042636 | Ga0466703_039149 | Ga0466703_039149_3227_3715 | 162 |
| 75 | 3300042643 | Ga0466704_478157 | Ga0466704_478157_1132_1620 | 162 |
| 76 | 3300038395 | Ga0415639_005208 | Ga0415639_005208_2043_2534 | 163 |
| 77 | 3300042590 | Ga0466690_117708 | Ga0466690_117708_26017_26508 | 163 |
| 78 | 3300042603 | Ga0466714_141997 | Ga0466714_141997_1739_2230 | 163 |
| 79 | 3300042609 | Ga0466722_265957 | Ga0466722_265957_2747_3238 | 163 |
| 80 | 3300042619 | Ga0466726_101410 | Ga0466726_101410_7066_7557 | 163 |
| 81 | 3300042655 | Ga0466727_329082 | Ga0466727_329082_2899_3390 | 163 |
| 82 | 3300042599 | Ga0466706_055330 | Ga0466706_055330_129_623 | 164 |
| 83 | 3300042612 | Ga0466705_257110 | Ga0466705_257110_3173_3667 | 164 |
| 84 | iso_pr_bacteria | 2820285501 | 2820287605 | 164 |
| 85 | 3300042596 | Ga0466696_256433 | Ga0466696_256433_1842_2339 | 165 |
| 86 | 3300042616 | Ga0466715_479803 | Ga0466715_479803_1030_1527 | 165 |
| 87 | 3300042619 | Ga0466726_173921 | Ga0466726_173921_1438_1935 | 165 |
| 88 | 3300042621 | Ga0466729_030073 | Ga0466729_030073_3521_4018 | 165 |
| 89 | 3300042655 | Ga0466727_022528 | Ga0466727_022528_1400_1897 | 165 |
| 90 | 3300042616 | Ga0466715_059755 | Ga0466715_059755_201_701 | 166 |
| 91 | 3300042617 | Ga0466718_093128 | Ga0466718_093128_1929_2432 | 167 |
| 92 | 3300010167 | Ga0123353_11390563 | Ga0123353_113905632 | 168 |
| 93 | 3300042604 | Ga0466717_187425 | Ga0466717_187425_778_1284 | 168 |
| 94 | 3300042616 | Ga0466715_051442 | Ga0466715_051442_581_1093 | 170 |
| 95 | 3300042616 | Ga0466715_095992 | Ga0466715_095992_3043_3555 | 170 |
| 96 | 3300042606 | Ga0466719_012647 | Ga0466719_012647_887_1402 | 171 |
| 97 | 3300042608 | Ga0466721_063185 | Ga0466721_063185_247_762 | 171 |
| 98 | 3300042616 | Ga0466715_557279 | Ga0466715_557279_870_1391 | 173 |
| 99 | 3300042593 | Ga0466691_007403 | Ga0466691_007403_1865_2389 | 174 |
| 100 | 3300009826 | Ga0123355_10020640 | Ga0123355_100206402 | 176 |
| 101 | 3300002462 | JGI24702J35022_10082192 | JGI24702J35022_100821922 | 177 |
| 102 | 3300010167 | Ga0123353_10033878 | Ga0123353_100338783 | 177 |
| 103 | 3300042596 | Ga0466696_339956 | Ga0466696_339956_611_1144 | 177 |
| 104 | 3300042596 | Ga0466696_215861 | Ga0466696_215861_641_1180 | 179 |
| 105 | iso_pr_bacteria | 2820240463 | 2820242520 | 181 |
| 106 | 3300010167 | Ga0123353_10634350 | Ga0123353_106343502 | 182 |
| 107 | 3300042636 | Ga0466703_268002 | Ga0466703_268002_4426_5031 | 195 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02542 | YgbB | YgbB family | 2 | 155 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.