Protein Family IF09188
Metagenome
Metatranscriptome
Isolate
285
Members
101
Samples
256
Scaffolds
112.97
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_196736|Ga0466703_196736_3618_4034
- Length
- 130 aa
- Sequence
- LFTKKLLNKLNYTKMADLKAFAEQLVNLTVKEVNELAEILKSEYGIEPAAAAVAAEVVEEKTSFDVVLKGAGANKLAIVKLVKELTGLGLKEAKDIVDSAPAPLKEGISKDEAEALKKSLEEAGAEVELK
Sample Types
Isolate
10.2%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.5%
Unclassified
18.7%
Kalotermitidae
15.4%
Blattidae
5.5%
Drosophilidae
4.4%
Armadillidiidae
4.4%
Culicidae
4.4%
Rhinotermitidae
4.4%
Termopsidae
4.4%
Formicidae
3.3%
Passalidae
2.2%
Hydrophilidae
1.1%
Daphniidae
1.1%
Hodotermitidae
1.1%
Bombycidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
255
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 2 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 3 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 4 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 16 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 19 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 20 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 21 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 26 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 27 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 28 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 29 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 32 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 33 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 34 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 35 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 36 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 37 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 38 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 39 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 46 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 47 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 48 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 57 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 58 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 59 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 62 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 63 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 64 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 65 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 66 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 67 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 68 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 69 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 70 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 71 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 72 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 73 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 74 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 75 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 76 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 77 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 78 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 79 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 80 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 81 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 82 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 83 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 84 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 85 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 86 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 87 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 88 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 89 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 90 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 91 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 92 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 93 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 94 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 95 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 96 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 97 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 98 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 99 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 100 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 101 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_191297 | 3300042591 | Unclassified | 1923 |
| 2 | Ga0466693_004116 | 3300042592 | Bacteria | 2449 |
| 3 | Ga0466696_205463 | 3300042596 | Bacteria | 14851 |
| 4 | Ga0466701_011726 | 3300042598 | Bacteria | 33085 |
| 5 | Ga0466707_167144 | 3300042601 | Bacteria | 17624 |
| 6 | Ga0466707_352844 | 3300042601 | Bacteria | 26463 |
| 7 | Ga0466714_076706 | 3300042603 | Unclassified | 1140 |
| 8 | Ga0466716_525306 | 3300042605 | Bacteria | 5994 |
| 9 | Ga0466719_339342 | 3300042606 | Unclassified | 1509 |
| 10 | Ga0466719_347329 | 3300042606 | Bacteria | 17028 |
| 11 | Ga0466722_015571 | 3300042609 | Bacteria | 4601 |
| 12 | Ga0123353_13316389 | 3300010167 | Unclassified | 513 |
| 13 | Ga0123354_10017108 | 3300010882 | Bacteria | 11357 |
| 14 | Ga0466710_041764 | 3300042613 | Bacteria | 1024 |
| 15 | Ga0466711_114673 | 3300042615 | Bacteria | 26019 |
| 16 | Ga0466711_413274 | 3300042615 | Bacteria | 6092 |
| 17 | Ga0466715_498399 | 3300042616 | Bacteria | 11022 |
| 18 | Ga0466715_595541 | 3300042616 | Bacteria | 19555 |
| 19 | Ga0466723_325833 | 3300042618 | Bacteria | 3912 |
| 20 | Ga0466728_237409 | 3300042620 | Unclassified | 1095 |
| 21 | Ga0466728_387610 | 3300042620 | Bacteria | 7426 |
| 22 | Ga0466733_107072 | 3300042659 | Unclassified | 3373 |
| 23 | Ga0466729_243854 | 3300042621 | Bacteria | 3433 |
| 24 | Ga0466735_000181 | 3300042624 | Bacteria | 1717 |
| 25 | Ga0466703_171755 | 3300042636 | Bacteria | 1580 |
| 26 | Ga0466703_196415 | 3300042636 | Bacteria | 1662 |
| 27 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 28 | Ga0466704_032859 | 3300042643 | Bacteria | 10876 |
| 29 | Ga0466704_079908 | 3300042643 | Bacteria | 14298 |
| 30 | Ga0466704_398314 | 3300042643 | Bacteria | 12888 |
| 31 | 2227465201 | 2225789004 | Bacteria | 5204 |
| 32 | IMNBL1DRAFT_c0000131 | 3300000062 | Bacteria | 66549 |
| 33 | Ga0068305_10000815 | 3300005083 | Bacteria | 27082 |
| 34 | Ga0104043_1010940 | 3300007058 | Bacteria | 1405 |
| 35 | Ga0160468_100100 | 3300012819 | Bacteria | 98045 |
| 36 | Ga0160448_112351 | 3300012854 | Unclassified | 1682 |
| 37 | Ga0466700_066795 | 3300042600 | Bacteria | 8239 |
| 38 | Ga0466707_300630 | 3300042601 | Unclassified | 2852 |
| 39 | Ga0466713_041013 | 3300042602 | Bacteria | 31505 |
| 40 | Ga0466716_238887 | 3300042605 | Bacteria | 28802 |
| 41 | Ga0466722_144286 | 3300042609 | Bacteria | 1129 |
| 42 | Ga0466698_453572 | 3300042610 | Bacteria | 2955 |
| 43 | Ga0123357_10025761 | 3300009784 | Bacteria | 7938 |
| 44 | Ga0123356_10313502 | 3300010049 | Bacteria | 1679 |
| 45 | Ga0123354_10136495 | 3300010882 | Bacteria | 3063 |
| 46 | Ga0466705_133082 | 3300042612 | Bacteria | 14815 |
| 47 | Ga0466705_441618 | 3300042612 | Bacteria | 2492 |
| 48 | Ga0466711_323186 | 3300042615 | Bacteria | 17765 |
| 49 | Ga0466723_317177 | 3300042618 | Bacteria | 5537 |
| 50 | Ga0466726_083057 | 3300042619 | Bacteria | 3917 |
| 51 | Ga0466729_139818 | 3300042621 | Bacteria | 7606 |
| 52 | Ga0466734_160703 | 3300042623 | Bacteria | 1613 |
| 53 | Ga0466703_010906 | 3300042636 | Bacteria | 2185 |
| 54 | Ga0466703_320865 | 3300042636 | Bacteria | 24807 |
| 55 | Ga0466709_014514 | 3300042648 | Bacteria | 492815 |
| 56 | Ga0466727_156687 | 3300042655 | Unclassified | 3435 |
| 57 | Ga0466727_162473 | 3300042655 | Bacteria | 1801 |
| 58 | JGI24699J35502_11132622 | 3300002509 | Bacteria | 7228 |
| 59 | Ga0466690_063433 | 3300042590 | Bacteria | 19681 |
| 60 | Ga0466696_173937 | 3300042596 | Bacteria | 3614 |
| 61 | Ga0466707_249166 | 3300042601 | Bacteria | 10280 |
| 62 | Ga0466713_049002 | 3300042602 | Bacteria | 11333 |
| 63 | Ga0466713_123387 | 3300042602 | Bacteria | 10600 |
| 64 | Ga0466722_247161 | 3300042609 | Bacteria | 1656 |
| 65 | Ga0123357_10065545 | 3300009784 | Bacteria | 4849 |
| 66 | Ga0123357_10227255 | 3300009784 | Unclassified | 2055 |
| 67 | Ga0123357_10612650 | 3300009784 | Unclassified | 828 |
| 68 | Ga0123353_13360270 | 3300010167 | Bacteria | 509 |
| 69 | Ga0466697_242593 | 3300042611 | Bacteria | 1065 |
| 70 | Ga0466715_034798 | 3300042616 | Bacteria | 6327 |
| 71 | Ga0466726_425392 | 3300042619 | Unclassified | 1850 |
| 72 | Ga0466733_032117 | 3300042659 | Bacteria | 41731 |
| 73 | Ga0466733_090575 | 3300042659 | Bacteria | 1128 |
| 74 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 75 | Ga0466734_026913 | 3300042623 | Bacteria | 1358 |
| 76 | Ga0466735_044240 | 3300042624 | Bacteria | 5840 |
| 77 | Ga0466703_056304 | 3300042636 | Bacteria | 4548 |
| 78 | Ga0466703_163585 | 3300042636 | Bacteria | 2649 |
| 79 | Ga0466703_200529 | 3300042636 | Bacteria | 2663 |
| 80 | Ga0466703_229654 | 3300042636 | Bacteria | 2055 |
| 81 | Ga0466727_344452 | 3300042655 | Bacteria | 7840 |
| 82 | IMNBL1DRAFT_c0002926 | 3300000062 | Bacteria | 11405 |
| 83 | JGI24699J35502_11018868 | 3300002509 | Bacteria | 1440 |
| 84 | JGI24699J35502_11133854 | 3300002509 | Bacteria | 17140 |
| 85 | Ga0068305_10370660 | 3300005083 | Bacteria | 979 |
| 86 | Ga0160445_103770 | 3300012847 | Unclassified | 2946 |
| 87 | Ga0466692_047378 | 3300042591 | Bacteria | 93081 |
| 88 | Ga0466696_124193 | 3300042596 | Bacteria | 7956 |
| 89 | Ga0466706_010686 | 3300042599 | Bacteria | 53689 |
| 90 | Ga0466706_028806 | 3300042599 | Bacteria | 10264 |
| 91 | Ga0466707_046647 | 3300042601 | Bacteria | 2986 |
| 92 | Ga0466707_088047 | 3300042601 | Bacteria | 21486 |
| 93 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 94 | Ga0466713_070245 | 3300042602 | Bacteria | 20718 |
| 95 | Ga0466713_104757 | 3300042602 | Bacteria | 74823 |
| 96 | Ga0466719_028770 | 3300042606 | Bacteria | 10194 |
| 97 | Ga0466719_513672 | 3300042606 | Bacteria | 11415 |
| 98 | Ga0466722_101228 | 3300042609 | Bacteria | 13354 |
| 99 | Ga0123357_10025320 | 3300009784 | Bacteria | 8001 |
| 100 | Ga0123357_10266085 | 3300009784 | Bacteria | 1801 |
| 101 | Ga0123356_10378954 | 3300010049 | Unclassified | 1547 |
| 102 | Ga0123353_10066272 | 3300010167 | Bacteria | 5796 |
| 103 | Ga0466711_043128 | 3300042615 | Bacteria | 56831 |
| 104 | Ga0466715_007590 | 3300042616 | Bacteria | 27073 |
| 105 | Ga0466715_060486 | 3300042616 | Bacteria | 10198 |
| 106 | Ga0466715_134918 | 3300042616 | Bacteria | 16436 |
| 107 | Ga0466726_011258 | 3300042619 | Bacteria | 19089 |
| 108 | Ga0466726_064395 | 3300042619 | Bacteria | 25606 |
| 109 | Ga0466728_202737 | 3300042620 | Bacteria | 14768 |
| 110 | Ga0466729_108663 | 3300042621 | Bacteria | 6139 |
| 111 | Ga0466729_175617 | 3300042621 | Bacteria | 10686 |
| 112 | Ga0466733_127447 | 3300042659 | Bacteria | 2807 |
| 113 | Ga0466735_037693 | 3300042624 | Unclassified | 1502 |
| 114 | Ga0466735_125092 | 3300042624 | Bacteria | 2338 |
| 115 | Ga0466735_206840 | 3300042624 | Bacteria | 5054 |
| 116 | Ga0466702_115816 | 3300042635 | Unclassified | 1796 |
| 117 | Ga0466703_153731 | 3300042636 | Bacteria | 6261 |
| 118 | Ga0466704_449682 | 3300042643 | Bacteria | 3196 |
| 119 | Ga0466704_535587 | 3300042643 | Bacteria | 1200 |
| 120 | Ga0466709_309597 | 3300042648 | Bacteria | 40669 |
| 121 | Ga0466727_010825 | 3300042655 | Bacteria | 5495 |
| 122 | IMNBL1DRAFT_c0000372 | 3300000062 | Bacteria | 38285 |
| 123 | JGI24702J35022_10305148 | 3300002462 | Unclassified | 940 |
| 124 | JGI24699J35502_11134041 | 3300002509 | Bacteria | 26254 |
| 125 | Ga0068302_10119081 | 3300005071 | Unclassified | 574 |
| 126 | Ga0160441_100017 | 3300012825 | Bacteria | 294372 |
| 127 | Ga0160431_101327 | 3300012828 | Bacteria | 7248 |
| 128 | Ga0160460_100002 | 3300012845 | Bacteria | 833437 |
| 129 | Ga0160457_1000023 | 3300012858 | Bacteria | 328177 |
| 130 | Ga0223682_1018890 | 3300021231 | Bacteria | 1009 |
| 131 | Ga0466690_227552 | 3300042590 | Bacteria | 11759 |
| 132 | Ga0466690_421471 | 3300042590 | Bacteria | 34577 |
| 133 | Ga0466692_062031 | 3300042591 | Bacteria | 2916 |
| 134 | Ga0466692_077125 | 3300042591 | Bacteria | 15957 |
| 135 | Ga0466691_050587 | 3300042593 | Bacteria | 28945 |
| 136 | Ga0466701_009192 | 3300042598 | Bacteria | 62914 |
| 137 | Ga0466707_015141 | 3300042601 | Bacteria | 8571 |
| 138 | Ga0466707_027733 | 3300042601 | Bacteria | 2040 |
| 139 | Ga0466707_161001 | 3300042601 | Bacteria | 8272 |
| 140 | Ga0466713_130066 | 3300042602 | Bacteria | 7412 |
| 141 | Ga0466713_131613 | 3300042602 | Bacteria | 10477 |
| 142 | Ga0466716_163313 | 3300042605 | Bacteria | 6326 |
| 143 | Ga0466698_036106 | 3300042610 | Bacteria | 3114 |
| 144 | Ga0123356_10364399 | 3300010049 | Unclassified | 1573 |
| 145 | Ga0123356_11562463 | 3300010049 | Bacteria | 816 |
| 146 | Ga0123354_10000184 | 3300010882 | Bacteria | 52522 |
| 147 | Ga0123354_10059047 | 3300010882 | Bacteria | 5692 |
| 148 | Ga0160454_100017 | 3300012798 | Bacteria | 326439 |
| 149 | Ga0466705_246551 | 3300042612 | Bacteria | 20411 |
| 150 | Ga0466710_297623 | 3300042613 | Bacteria | 1394 |
| 151 | Ga0466712_258913 | 3300042614 | Bacteria | 1233 |
| 152 | Ga0466729_072533 | 3300042621 | Bacteria | 11377 |
| 153 | Ga0466732_038868 | 3300042656 | Unclassified | 1041 |
| 154 | Ga0466733_114757 | 3300042659 | Bacteria | 1821 |
| 155 | Ga0466733_174640 | 3300042659 | Bacteria | 1357 |
| 156 | Ga0466731_411267 | 3300042622 | Bacteria | 1832 |
| 157 | Ga0466735_059659 | 3300042624 | Unclassified | 1921 |
| 158 | Ga0466735_107158 | 3300042624 | Bacteria | 7011 |
| 159 | Ga0466735_148489 | 3300042624 | Bacteria | 3406 |
| 160 | Ga0466735_178022 | 3300042624 | Unclassified | 2484 |
| 161 | Ga0466709_147157 | 3300042648 | Bacteria | 6659 |
| 162 | Ga0466708_007634 | 3300042652 | Bacteria | 16863 |
| 163 | Ga0466708_130167 | 3300042652 | Bacteria | 53436 |
| 164 | Ga0466725_135951 | 3300042654 | Bacteria | 2926 |
| 165 | IMNBL1DRAFT_c0015378 | 3300000062 | Bacteria | 3322 |
| 166 | IMNBL1DRAFT_c0025218 | 3300000062 | Bacteria | 2285 |
| 167 | CVPL010W_10002015 | 3300002931 | Bacteria | 23907 |
| 168 | Ga0072941_1084245 | 3300005201 | Bacteria | 4292 |
| 169 | Ga0104045_1024185 | 3300007085 | Unclassified | 2485 |
| 170 | Ga0104041_1033617 | 3300007106 | Unclassified | 1699 |
| 171 | Ga0160459_100032 | 3300012831 | Bacteria | 260734 |
| 172 | Ga0466690_323038 | 3300042590 | Bacteria | 27612 |
| 173 | Ga0466694_131066 | 3300042594 | Unclassified | 2667 |
| 174 | Ga0466696_482389 | 3300042596 | Bacteria | 1829 |
| 175 | Ga0466713_135469 | 3300042602 | Bacteria | 58117 |
| 176 | Ga0466714_129177 | 3300042603 | Bacteria | 2969 |
| 177 | Ga0466716_166359 | 3300042605 | Bacteria | 5403 |
| 178 | Ga0466719_210124 | 3300042606 | Bacteria | 10174 |
| 179 | Ga0466719_347488 | 3300042606 | Bacteria | 6993 |
| 180 | Ga0466722_216312 | 3300042609 | Bacteria | 6465 |
| 181 | Ga0123353_10839048 | 3300010167 | Bacteria | 1262 |
| 182 | Ga0123353_11389096 | 3300010167 | Bacteria | 904 |
| 183 | Ga0123354_10136184 | 3300010882 | Bacteria | 3069 |
| 184 | Ga0466697_086200 | 3300042611 | Bacteria | 1191 |
| 185 | Ga0466705_404631 | 3300042612 | Unclassified | 4925 |
| 186 | Ga0466715_271893 | 3300042616 | Bacteria | 43585 |
| 187 | Ga0466715_609252 | 3300042616 | Bacteria | 3287 |
| 188 | Ga0466733_158876 | 3300042659 | Bacteria | 3877 |
| 189 | Ga0466730_037458 | 3300042625 | Bacteria | 3936 |
| 190 | Ga0466703_196736 | 3300042636 | Bacteria | 4722 |
| 191 | Ga0466725_420578 | 3300042654 | Bacteria | 1014 |
| 192 | Ga0466727_044212 | 3300042655 | Bacteria | 34323 |
| 193 | Ga0466727_238997 | 3300042655 | Bacteria | 1907 |
| 194 | 2227489255 | 2225789004 | Bacteria | 800 |
| 195 | IMNBL1DRAFT_c0001799 | 3300000062 | Bacteria | 15645 |
| 196 | IMNBL1DRAFT_c0017989 | 3300000062 | Bacteria | 2951 |
| 197 | JGI24702J35022_10012499 | 3300002462 | Bacteria | 4716 |
| 198 | JGI24699J35502_11133895 | 3300002509 | Bacteria | 18486 |
| 199 | Ga0068305_10015932 | 3300005083 | Bacteria | 27809 |
| 200 | Ga0102740_1000658 | 3300007140 | Bacteria | 9354 |
| 201 | Ga0160453_100034 | 3300012814 | Bacteria | 178692 |
| 202 | Ga0160452_102897 | 3300012834 | Bacteria | 3299 |
| 203 | Ga0466657_336554 | 3300042582 | Unclassified | 2405 |
| 204 | Ga0466692_030052 | 3300042591 | Bacteria | 80804 |
| 205 | Ga0466691_178014 | 3300042593 | Bacteria | 56681 |
| 206 | Ga0466694_381945 | 3300042594 | Bacteria | 1166 |
| 207 | Ga0466696_447293 | 3300042596 | Bacteria | 24793 |
| 208 | Ga0466701_005701 | 3300042598 | Bacteria | 1803 |
| 209 | Ga0466701_053727 | 3300042598 | Bacteria | 58706 |
| 210 | Ga0466713_120331 | 3300042602 | Bacteria | 12025 |
| 211 | Ga0466714_059109 | 3300042603 | Bacteria | 3629 |
| 212 | Ga0466722_015754 | 3300042609 | Bacteria | 4601 |
| 213 | Ga0123357_10100933 | 3300009784 | Bacteria | 3721 |
| 214 | Ga0123354_10085230 | 3300010882 | Bacteria | 4428 |
| 215 | Ga0123354_10600860 | 3300010882 | Bacteria | 806 |
| 216 | Ga0466705_523510 | 3300042612 | Bacteria | 13534 |
| 217 | Ga0466711_501759 | 3300042615 | Bacteria | 10416 |
| 218 | Ga0466715_120325 | 3300042616 | Bacteria | 14164 |
| 219 | Ga0466715_357141 | 3300042616 | Bacteria | 2096 |
| 220 | Ga0466726_192814 | 3300042619 | Unclassified | 1095 |
| 221 | Ga0466734_051725 | 3300042623 | Bacteria | 2478 |
| 222 | Ga0466734_103681 | 3300042623 | Bacteria | 1223 |
| 223 | Ga0466735_030119 | 3300042624 | Bacteria | 2906 |
| 224 | Ga0466735_145076 | 3300042624 | Bacteria | 15467 |
| 225 | Ga0466703_173046 | 3300042636 | Bacteria | 32889 |
| 226 | Ga0466704_436606 | 3300042643 | Unclassified | 4357 |
| 227 | Ga0466709_117347 | 3300042648 | Bacteria | 10931 |
| 228 | 2227475783 | 2225789004 | Bacteria | 887 |
| 229 | IMNBL1DRAFT_c0000519 | 3300000062 | Bacteria | 31668 |
| 230 | JGI24702J35022_10025283 | 3300002462 | Bacteria | 3205 |
| 231 | Ga0102734_1002993 | 3300007129 | Bacteria | 8287 |
| 232 | Ga0160469_100054 | 3300012824 | Bacteria | 198457 |
| 233 | Ga0160460_100029 | 3300012845 | Bacteria | 324685 |
| 234 | Ga0160457_1006560 | 3300012858 | Unclassified | 1728 |
| 235 | Ga0466690_092689 | 3300042590 | Bacteria | 81043 |
| 236 | Ga0466692_064075 | 3300042591 | Bacteria | 26726 |
| 237 | Ga0466691_155305 | 3300042593 | Bacteria | 5444 |
| 238 | Ga0466694_068992 | 3300042594 | Bacteria | 1476 |
| 239 | Ga0466696_361353 | 3300042596 | Bacteria | 10716 |
| 240 | Ga0466707_167629 | 3300042601 | Bacteria | 52999 |
| 241 | Ga0466713_073650 | 3300042602 | Bacteria | 22168 |
| 242 | Ga0466714_020760 | 3300042603 | Bacteria | 14729 |
| 243 | Ga0466714_138404 | 3300042603 | Bacteria | 1065 |
| 244 | Ga0123357_10016001 | 3300009784 | Bacteria | 9852 |
| 245 | Ga0123357_10866401 | 3300009784 | Bacteria | 592 |
| 246 | Ga0123355_10000772 | 3300009826 | Bacteria | 43687 |
| 247 | Ga0123353_10691850 | 3300010167 | Bacteria | 1433 |
| 248 | Ga0123354_10000799 | 3300010882 | Bacteria | 34399 |
| 249 | Ga0466723_168647 | 3300042618 | Bacteria | 10942 |
| 250 | Ga0466726_343709 | 3300042619 | Bacteria | 12383 |
| 251 | Ga0466734_015649 | 3300042623 | Bacteria | 2408 |
| 252 | Ga0466703_262133 | 3300042636 | Bacteria | 48736 |
| 253 | Ga0466704_020964 | 3300042643 | Bacteria | 3642 |
| 254 | Ga0466704_423430 | 3300042643 | Bacteria | 43182 |
| 255 | 2227486592 | 2225789004 | Bacteria | 4230 |
| 256 | Ga0123357_10000935 | 3300009784 | Bacteria | 29731 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.