Protein Family IF09173
Metagenome
Isolate
315
Members
112
Samples
267
Scaffolds
131.76
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_176395|Ga0466703_176395_1924_2400
- Length
- 158 aa
- Sequence
- MRNYAKQKSVMSVKYCSENPNQFNLNFMTDPIADYLTRLRNAIKAKHRVVDIPASNLKKEITKILFDKGYILNYKFVEEGPQGTIKIALKYNLVNKVNAIKNLKRVSSPGLRRYAGYKEMPRVLNGLGVAVLSTSKGVMTDKEARDQKIGGEVLCYIY
Sample Types
Isolate
15.2%
Metagenome
84.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.7%
Blattidae
21.7%
Kalotermitidae
13.2%
Unclassified
10.4%
Rhinotermitidae
5.7%
Formicidae
4.7%
Blattellidae
3.8%
Termopsidae
3.8%
Drosophilidae
2.8%
Passalidae
2.8%
Hydrophilidae
1.9%
Daphniidae
0.9%
Pseudophyllodromiidae
0.9%
Cryptocercidae
0.9%
Hodotermitidae
0.9%
Bombycidae
0.9%
Blaberidae
0.9%
Tenebrionidae
0.9%
Nephropidae
0.9%
Taxonomy
Archaea
0
Bacteria
298
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 2 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 3 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 4 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 9 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 17 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 18 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 19 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 20 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 21 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 28 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 29 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 30 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 31 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 32 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 33 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 34 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 37 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010053 | Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA | Metagenome | Cryptocercidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 44 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 51 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 52 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 53 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 54 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 55 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 56 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 57 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 58 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 59 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 60 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 61 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 62 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 63 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 64 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 65 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 66 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 67 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 68 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 69 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 70 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 71 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 72 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 73 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 74 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 75 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 76 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 77 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 78 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 79 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 80 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 81 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 82 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 83 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 84 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 85 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 86 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 87 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 88 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 89 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 90 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 91 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 92 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 93 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 94 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 95 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 96 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 97 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 98 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 99 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 100 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 101 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 102 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 103 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 104 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 105 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 106 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 107 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 108 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 109 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 110 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 111 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 112 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 2 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 3 | Ga0466729_282192 | 3300042621 | Bacteria | 3746 |
| 4 | Ga0466735_064263 | 3300042624 | Bacteria | 2824 |
| 5 | Ga0466735_177951 | 3300042624 | Bacteria | 10162 |
| 6 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 7 | Ga0466703_176395 | 3300042636 | Bacteria | 15139 |
| 8 | Ga0466704_432261 | 3300042643 | Bacteria | 4580 |
| 9 | Ga0466704_552057 | 3300042643 | Bacteria | 6449 |
| 10 | Ga0466704_619871 | 3300042643 | Bacteria | 22946 |
| 11 | Ga0466709_235305 | 3300042648 | Bacteria | 3321 |
| 12 | Ga0456237_0000012 | 3300041968 | Bacteria | 42362 |
| 13 | Ga0466693_219635 | 3300042592 | Bacteria | 3760 |
| 14 | Ga0466696_040254 | 3300042596 | Bacteria | 1680 |
| 15 | Ga0466715_076088 | 3300042616 | Bacteria | 9712 |
| 16 | Ga0466718_124700 | 3300042617 | Bacteria | 1135 |
| 17 | Ga0466729_056072 | 3300042621 | Bacteria | 21161 |
| 18 | Ga0466701_050773 | 3300042598 | Bacteria | 1055 |
| 19 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 20 | Ga0466713_022772 | 3300042602 | Bacteria | 15388 |
| 21 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 22 | Ga0466716_231031 | 3300042605 | Bacteria | 6941 |
| 23 | Ga0466719_246678 | 3300042606 | Bacteria | 8577 |
| 24 | Ga0466722_077240 | 3300042609 | Bacteria | 7055 |
| 25 | Ga0466722_161726 | 3300042609 | Bacteria | 14778 |
| 26 | 2227477137 | 2225789004 | Bacteria | 4589 |
| 27 | JGI24702J35022_10227061 | 3300002462 | Bacteria | 1078 |
| 28 | Ga0068305_10061301 | 3300005083 | Bacteria | 11640 |
| 29 | Ga0466705_058096 | 3300042612 | Bacteria | 11192 |
| 30 | Ga0466733_052339 | 3300042659 | Bacteria | 35317 |
| 31 | Ga0466733_074718 | 3300042659 | Bacteria | 2991 |
| 32 | Ga0466733_144713 | 3300042659 | Bacteria | 6687 |
| 33 | Ga0466733_197911 | 3300042659 | Bacteria | 1964 |
| 34 | Ga0123357_10040344 | 3300009784 | Bacteria | 6346 |
| 35 | Ga0123357_10057959 | 3300009784 | Bacteria | 5203 |
| 36 | Ga0123356_12449715 | 3300010049 | Bacteria | 653 |
| 37 | Ga0466729_243779 | 3300042621 | Bacteria | 6142 |
| 38 | Ga0466735_014617 | 3300042624 | Bacteria | 1887 |
| 39 | Ga0466735_078473 | 3300042624 | Bacteria | 1166 |
| 40 | Ga0466735_152196 | 3300042624 | Bacteria | 3972 |
| 41 | Ga0466704_017562 | 3300042643 | Unclassified | 1905 |
| 42 | Ga0466704_541626 | 3300042643 | Bacteria | 3198 |
| 43 | Ga0466725_286288 | 3300042654 | Bacteria | 3552 |
| 44 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 45 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 46 | Ga0466691_103922 | 3300042593 | Bacteria | 19126 |
| 47 | Ga0466696_079953 | 3300042596 | Bacteria | 4070 |
| 48 | Ga0466710_039997 | 3300042613 | Bacteria | 3114 |
| 49 | Ga0466711_011252 | 3300042615 | Bacteria | 11053 |
| 50 | Ga0466711_189861 | 3300042615 | Bacteria | 40824 |
| 51 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 52 | Ga0466715_177954 | 3300042616 | Bacteria | 14578 |
| 53 | Ga0466715_372457 | 3300042616 | Bacteria | 41034 |
| 54 | Ga0466723_219374 | 3300042618 | Unclassified | 1807 |
| 55 | Ga0466726_271572 | 3300042619 | Bacteria | 26331 |
| 56 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 57 | Ga0466701_076335 | 3300042598 | Bacteria | 60822 |
| 58 | Ga0466713_039539 | 3300042602 | Unclassified | 7063 |
| 59 | Ga0466716_501317 | 3300042605 | Bacteria | 2818 |
| 60 | Ga0466719_469556 | 3300042606 | Unclassified | 1070 |
| 61 | Ga0466722_117304 | 3300042609 | Bacteria | 122884 |
| 62 | IMNBL1DRAFT_c0000355 | 3300000062 | Bacteria | 38787 |
| 63 | IMNBL1DRAFT_c0000682 | 3300000062 | Bacteria | 27226 |
| 64 | IMNBL1DRAFT_c0041101 | 3300000062 | Bacteria | 1557 |
| 65 | IMNBL1DRAFT_c0068657 | 3300000062 | Unclassified | 1032 |
| 66 | JGI24705J35276_12164918 | 3300002504 | Bacteria | 1255 |
| 67 | JGI24705J35276_12219018 | 3300002504 | Bacteria | 2179 |
| 68 | JGI24699J35502_11133946 | 3300002509 | Bacteria | 20622 |
| 69 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 70 | Ga0068305_10103751 | 3300005083 | Bacteria | 1616 |
| 71 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 72 | Ga0466705_301731 | 3300042612 | Bacteria | 5712 |
| 73 | Ga0123357_10370376 | 3300009784 | Bacteria | 1343 |
| 74 | Ga0123353_10000019 | 3300010167 | Bacteria | 185006 |
| 75 | Ga0123353_10164495 | 3300010167 | Bacteria | 3528 |
| 76 | Ga0466704_192770 | 3300042643 | Bacteria | 2947 |
| 77 | Ga0466704_469392 | 3300042643 | Bacteria | 2729 |
| 78 | Ga0466708_462678 | 3300042652 | Bacteria | 4616 |
| 79 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 80 | Ga0466725_255972 | 3300042654 | Bacteria | 39464 |
| 81 | Ga0466690_075785 | 3300042590 | Bacteria | 45904 |
| 82 | Ga0466690_248346 | 3300042590 | Bacteria | 4114 |
| 83 | Ga0466692_009748 | 3300042591 | Unclassified | 1324 |
| 84 | Ga0466691_066359 | 3300042593 | Bacteria | 26336 |
| 85 | Ga0466696_090243 | 3300042596 | Bacteria | 10365 |
| 86 | Ga0466696_326056 | 3300042596 | Bacteria | 4113 |
| 87 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 88 | Ga0466711_226259 | 3300042615 | Bacteria | 4193 |
| 89 | Ga0466711_486497 | 3300042615 | Bacteria | 6767 |
| 90 | Ga0466715_153338 | 3300042616 | Bacteria | 101125 |
| 91 | Ga0466726_024142 | 3300042619 | Bacteria | 22843 |
| 92 | Ga0466726_242160 | 3300042619 | Bacteria | 13880 |
| 93 | Ga0466728_371680 | 3300042620 | Bacteria | 8915 |
| 94 | Ga0466706_217013 | 3300042599 | Bacteria | 1916 |
| 95 | Ga0466706_237229 | 3300042599 | Bacteria | 5073 |
| 96 | Ga0466713_021681 | 3300042602 | Bacteria | 1307 |
| 97 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 98 | Ga0466713_035081 | 3300042602 | Bacteria | 6541 |
| 99 | Ga0466713_083156 | 3300042602 | Unclassified | 1291 |
| 100 | Ga0466716_240704 | 3300042605 | Bacteria | 7499 |
| 101 | Ga0466722_073972 | 3300042609 | Bacteria | 128406 |
| 102 | Ga0466722_127886 | 3300042609 | Bacteria | 6387 |
| 103 | IMNBGM34_c004877 | 3300000036 | Bacteria | 1797 |
| 104 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 105 | IMNBL1DRAFT_c0012380 | 3300000062 | Bacteria | 3905 |
| 106 | JGI24698J34947_10009875 | 3300002449 | Bacteria | 5232 |
| 107 | JGI24702J35022_10002597 | 3300002462 | Bacteria | 10970 |
| 108 | JGI24702J35022_10029452 | 3300002462 | Bacteria | 2947 |
| 109 | Ga0068302_10164744 | 3300005071 | Bacteria | 1908 |
| 110 | Ga0072941_1545031 | 3300005201 | Bacteria | 1420 |
| 111 | Ga0466697_212074 | 3300042611 | Bacteria | 3433 |
| 112 | Ga0466705_350476 | 3300042612 | Bacteria | 1615 |
| 113 | Ga0466733_208857 | 3300042659 | Bacteria | 1348 |
| 114 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 115 | Ga0123357_10132820 | 3300009784 | Unclassified | 3091 |
| 116 | Ga0123354_10000498 | 3300010882 | Bacteria | 39457 |
| 117 | Ga0466735_207101 | 3300042624 | Unclassified | 1064 |
| 118 | Ga0466703_105741 | 3300042636 | Bacteria | 30105 |
| 119 | Ga0466703_234996 | 3300042636 | Bacteria | 1132 |
| 120 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 121 | Ga0160441_100482 | 3300012825 | Bacteria | 29148 |
| 122 | Ga0466690_110824 | 3300042590 | Bacteria | 8694 |
| 123 | Ga0466690_163569 | 3300042590 | Bacteria | 16378 |
| 124 | Ga0466690_212563 | 3300042590 | Bacteria | 2638 |
| 125 | Ga0466696_201817 | 3300042596 | Bacteria | 41274 |
| 126 | Ga0466696_312122 | 3300042596 | Bacteria | 7170 |
| 127 | Ga0466728_421279 | 3300042620 | Bacteria | 4461 |
| 128 | Ga0466707_141064 | 3300042601 | Bacteria | 19817 |
| 129 | Ga0466713_079678 | 3300042602 | Bacteria | 62372 |
| 130 | Ga0466713_129806 | 3300042602 | Bacteria | 35433 |
| 131 | Ga0466722_052375 | 3300042609 | Bacteria | 1188 |
| 132 | Ga0466722_207156 | 3300042609 | Bacteria | 3849 |
| 133 | Ga0466698_381561 | 3300042610 | Bacteria | 3036 |
| 134 | JGI24702J35022_10004210 | 3300002462 | Bacteria | 8590 |
| 135 | Ga0068305_10085917 | 3300005083 | Bacteria | 6918 |
| 136 | Ga0104045_1006496 | 3300007085 | Bacteria | 6140 |
| 137 | Ga0104041_1128281 | 3300007106 | Bacteria | 789 |
| 138 | Ga0134290_1112291 | 3300010053 | Unclassified | 618 |
| 139 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 140 | Ga0466704_533188 | 3300042643 | Bacteria | 20326 |
| 141 | Ga0466727_260920 | 3300042655 | Bacteria | 6356 |
| 142 | Ga0466696_019411 | 3300042596 | Bacteria | 1333 |
| 143 | Ga0466696_479576 | 3300042596 | Bacteria | 3153 |
| 144 | Ga0466712_053087 | 3300042614 | Bacteria | 1959 |
| 145 | Ga0466711_469917 | 3300042615 | Bacteria | 2363 |
| 146 | Ga0466715_434053 | 3300042616 | Bacteria | 17606 |
| 147 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 148 | Ga0466726_462884 | 3300042619 | Bacteria | 2272 |
| 149 | Ga0466728_292510 | 3300042620 | Bacteria | 40918 |
| 150 | Ga0466701_098566 | 3300042598 | Bacteria | 20155 |
| 151 | Ga0466706_206977 | 3300042599 | Bacteria | 1438 |
| 152 | Ga0466700_143196 | 3300042600 | Bacteria | 14202 |
| 153 | Ga0466707_398960 | 3300042601 | Bacteria | 15809 |
| 154 | Ga0466713_127060 | 3300042602 | Bacteria | 78606 |
| 155 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 156 | Ga0466722_210785 | 3300042609 | Bacteria | 4412 |
| 157 | 2227290536 | 2225789004 | Unclassified | 1241 |
| 158 | 2227471891 | 2225789004 | Bacteria | 917 |
| 159 | IMNBL1DRAFT_c0000687 | 3300000062 | Bacteria | 27159 |
| 160 | IMNBL1DRAFT_c0003450 | 3300000062 | Bacteria | 10155 |
| 161 | JGI24705J35276_12227509 | 3300002504 | Bacteria | 3016 |
| 162 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 163 | Ga0102735_1002384 | 3300007080 | Bacteria | 2870 |
| 164 | Ga0466705_023652 | 3300042612 | Bacteria | 16774 |
| 165 | Ga0466705_384350 | 3300042612 | Bacteria | 1149 |
| 166 | Ga0123356_11630111 | 3300010049 | Bacteria | 799 |
| 167 | Ga0134290_1264530 | 3300010053 | Bacteria | 705 |
| 168 | Ga0123353_10003138 | 3300010167 | Bacteria | 20743 |
| 169 | Ga0123353_11360614 | 3300010167 | Unclassified | 916 |
| 170 | Ga0466731_134384 | 3300042622 | Unclassified | 1025 |
| 171 | Ga0466703_073446 | 3300042636 | Bacteria | 8423 |
| 172 | Ga0466704_415186 | 3300042643 | Bacteria | 17633 |
| 173 | Ga0466709_266727 | 3300042648 | Bacteria | 3133 |
| 174 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 175 | Ga0466692_183985 | 3300042591 | Bacteria | 2926 |
| 176 | Ga0466696_089029 | 3300042596 | Bacteria | 1061 |
| 177 | Ga0466705_502503 | 3300042612 | Bacteria | 16070 |
| 178 | Ga0466711_228133 | 3300042615 | Bacteria | 7712 |
| 179 | Ga0466715_013468 | 3300042616 | Bacteria | 26887 |
| 180 | Ga0466715_253613 | 3300042616 | Bacteria | 5665 |
| 181 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 182 | Ga0466700_405093 | 3300042600 | Bacteria | 5125 |
| 183 | Ga0466707_157624 | 3300042601 | Bacteria | 13208 |
| 184 | Ga0466707_190959 | 3300042601 | Bacteria | 10157 |
| 185 | Ga0466713_017440 | 3300042602 | Bacteria | 108493 |
| 186 | Ga0466713_051789 | 3300042602 | Bacteria | 1591 |
| 187 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 188 | Ga0466713_121249 | 3300042602 | Bacteria | 3201 |
| 189 | Ga0466714_150740 | 3300042603 | Bacteria | 1489 |
| 190 | Ga0466716_335360 | 3300042605 | Bacteria | 11224 |
| 191 | Ga0466698_327264 | 3300042610 | Bacteria | 8551 |
| 192 | 2227473843 | 2225789004 | Bacteria | 902 |
| 193 | JGI24702J35022_10453175 | 3300002462 | Bacteria | 781 |
| 194 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 195 | JGI24696J40584_12957240 | 3300002834 | Bacteria | 3416 |
| 196 | Ga0104041_1111365 | 3300007106 | Bacteria | 2017 |
| 197 | Ga0466732_238214 | 3300042656 | Bacteria | 1778 |
| 198 | Ga0466732_296537 | 3300042656 | Bacteria | 1670 |
| 199 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 200 | Ga0123356_10396936 | 3300010049 | Bacteria | 1516 |
| 201 | Ga0123356_10446596 | 3300010049 | Bacteria | 1440 |
| 202 | Ga0123356_10882630 | 3300010049 | Unclassified | 1065 |
| 203 | Ga0123353_10418276 | 3300010167 | Bacteria | 1987 |
| 204 | Ga0123353_10523992 | 3300010167 | Bacteria | 1719 |
| 205 | Ga0123353_11213897 | 3300010167 | Bacteria | 988 |
| 206 | Ga0123353_12032916 | 3300010167 | Bacteria | 702 |
| 207 | Ga0466735_071242 | 3300042624 | Bacteria | 4680 |
| 208 | Ga0466703_027519 | 3300042636 | Bacteria | 2324 |
| 209 | Ga0466703_109702 | 3300042636 | Bacteria | 21153 |
| 210 | Ga0466703_279649 | 3300042636 | Bacteria | 29017 |
| 211 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 212 | Ga0466724_53803 | 3300042649 | Bacteria | 7886 |
| 213 | Ga0466727_009300 | 3300042655 | Bacteria | 1757 |
| 214 | Ga0466727_175984 | 3300042655 | Bacteria | 3199 |
| 215 | Ga0466727_231897 | 3300042655 | Bacteria | 4151 |
| 216 | Ga0466727_289772 | 3300042655 | Bacteria | 14123 |
| 217 | Ga0466692_157620 | 3300042591 | Bacteria | 1082 |
| 218 | Ga0466692_161873 | 3300042591 | Bacteria | 51547 |
| 219 | Ga0466691_107488 | 3300042593 | Bacteria | 2026 |
| 220 | Ga0466711_086148 | 3300042615 | Bacteria | 1881 |
| 221 | Ga0466715_044375 | 3300042616 | Bacteria | 14700 |
| 222 | Ga0466715_231188 | 3300042616 | Bacteria | 1518 |
| 223 | Ga0466715_610116 | 3300042616 | Bacteria | 1104 |
| 224 | Ga0466707_194386 | 3300042601 | Bacteria | 27039 |
| 225 | Ga0466707_207725 | 3300042601 | Bacteria | 3855 |
| 226 | Ga0466713_026562 | 3300042602 | Bacteria | 15627 |
| 227 | Ga0466713_096596 | 3300042602 | Bacteria | 406546 |
| 228 | Ga0466713_113019 | 3300042602 | Bacteria | 16771 |
| 229 | Ga0466714_107938 | 3300042603 | Bacteria | 5958 |
| 230 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 231 | Ga0466722_108524 | 3300042609 | Bacteria | 6122 |
| 232 | Ga0466722_143981 | 3300042609 | Bacteria | 20003 |
| 233 | 2227466257 | 2225789004 | Bacteria | 966 |
| 234 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 235 | JGI24702J35022_10008763 | 3300002462 | Bacteria | 5711 |
| 236 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 237 | Ga0103263_101903 | 3300007042 | Bacteria | 2647 |
| 238 | Ga0102740_1000340 | 3300007140 | Bacteria | 13154 |
| 239 | Ga0466705_373160 | 3300042612 | Bacteria | 25790 |
| 240 | Ga0466733_221527 | 3300042659 | Bacteria | 2376 |
| 241 | Ga0123356_12779224 | 3300010049 | Bacteria | 613 |
| 242 | Ga0466729_318464 | 3300042621 | Bacteria | 5684 |
| 243 | Ga0466724_28405 | 3300042649 | Bacteria | 7792 |
| 244 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 245 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
| 246 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 247 | Ga0466690_175771 | 3300042590 | Bacteria | 56622 |
| 248 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 249 | Ga0466710_178175 | 3300042613 | Bacteria | 2134 |
| 250 | Ga0466711_050658 | 3300042615 | Bacteria | 24311 |
| 251 | Ga0466715_265725 | 3300042616 | Bacteria | 12007 |
| 252 | Ga0466726_361642 | 3300042619 | Bacteria | 6372 |
| 253 | Ga0466726_494833 | 3300042619 | Bacteria | 4829 |
| 254 | Ga0466706_169251 | 3300042599 | Bacteria | 2322 |
| 255 | Ga0466700_076796 | 3300042600 | Bacteria | 9313 |
| 256 | Ga0466700_458823 | 3300042600 | Unclassified | 1242 |
| 257 | Ga0466707_123522 | 3300042601 | Bacteria | 8117 |
| 258 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 259 | Ga0466713_018853 | 3300042602 | Bacteria | 13634 |
| 260 | Ga0466713_112803 | 3300042602 | Bacteria | 145809 |
| 261 | Ga0466719_204065 | 3300042606 | Bacteria | 20051 |
| 262 | Ga0466719_214476 | 3300042606 | Bacteria | 1782 |
| 263 | 2227133585 | 2225789004 | Bacteria | 8869 |
| 264 | JGI24702J35022_10744811 | 3300002462 | Unclassified | 610 |
| 265 | CVPL010W_10000676 | 3300002931 | Bacteria | 64066 |
| 266 | Ga0102734_1006096 | 3300007129 | Unclassified | 2696 |
| 267 | Ga0104050_1212478 | 3300007153 | Bacteria | 897 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00410 | Ribosomal_S8 | Ribosomal protein S8 | 30 | 158 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.