Protein Family IF09139
Metagenome
Isolate
186
Members
68
Samples
162
Scaffolds
203.68
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_098605|Ga0466703_098605_6064_6765
- Length
- 233 aa
- Sequence
- MKCEQLTENSNQKKLPGTFIEVLVIKNNNMKIIAVGMNYADHNKELQNTLLTEEPVIFMKSDSALLKDGKPFFLPDFSSEIHYETEVVIRINKLGKNIAGQFAHRYYSEVTVGIDFTARDLQRSLRQRGLPWEICKGFDQSAVIGDFVPLSEIGQVQNIDFSLEIDERCVQRDNTSNMLFTVDEIIAYVSRFFTLKIGDLIFTGTPSGVGEVQTGNHLKGYIGNKKLLDFYVR
Sample Types
Isolate
12.9%
Metagenome
87.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
25.8%
Termitidae
24.2%
Kalotermitidae
19.7%
Unclassified
7.6%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Elmidae
3.0%
Passalidae
3.0%
Drosophilidae
3.0%
Daphniidae
1.5%
Hodotermitidae
1.5%
Cambaridae
1.5%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 2 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 3 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 4 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 5 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 8 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 9 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 10 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 11 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 12 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 17 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 18 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 19 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 20 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 29 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 30 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 31 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 32 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 60 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 63 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10006254 | 3300009784 | Bacteria | 14468 |
| 2 | Ga0123354_10001986 | 3300010882 | Bacteria | 26232 |
| 3 | Ga0466715_149950 | 3300042616 | Bacteria | 4801 |
| 4 | Ga0466715_583205 | 3300042616 | Bacteria | 24186 |
| 5 | Ga0466729_063676 | 3300042621 | Bacteria | 2168 |
| 6 | Ga0466690_246577 | 3300042590 | Bacteria | 16883 |
| 7 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 8 | Ga0466691_148747 | 3300042593 | Bacteria | 15449 |
| 9 | Ga0466695_340885 | 3300042595 | Bacteria | 2868 |
| 10 | Ga0466735_103703 | 3300042624 | Bacteria | 8863 |
| 11 | Ga0466735_233659 | 3300042624 | Bacteria | 1540 |
| 12 | Ga0466725_151340 | 3300042654 | Bacteria | 1517 |
| 13 | Ga0074306_1122697 | 3300005309 | Bacteria | 914 |
| 14 | Ga0466706_264957 | 3300042599 | Bacteria | 2690 |
| 15 | Ga0466707_180224 | 3300042601 | Bacteria | 1292 |
| 16 | Ga0466713_070253 | 3300042602 | Bacteria | 4805 |
| 17 | Ga0466697_012774 | 3300042611 | Bacteria | 1420 |
| 18 | Ga0466733_101505 | 3300042659 | Bacteria | 3676 |
| 19 | Ga0123357_10092520 | 3300009784 | Bacteria | 3934 |
| 20 | Ga0123354_10058861 | 3300010882 | Bacteria | 5704 |
| 21 | Ga0466711_194370 | 3300042615 | Bacteria | 1084 |
| 22 | Ga0466715_138304 | 3300042616 | Bacteria | 7514 |
| 23 | Ga0466726_423872 | 3300042619 | Bacteria | 2193 |
| 24 | Ga0466693_336039 | 3300042592 | Bacteria | 2339 |
| 25 | Ga0466709_095978 | 3300042648 | Bacteria | 34809 |
| 26 | Ga0466727_101745 | 3300042655 | Bacteria | 2139 |
| 27 | 2227524342 | 2225789004 | Bacteria | 3277 |
| 28 | JGI24696J40584_12842128 | 3300002834 | Bacteria | 957 |
| 29 | Ga0466707_016891 | 3300042601 | Bacteria | 35922 |
| 30 | Ga0466716_390504 | 3300042605 | Bacteria | 5665 |
| 31 | Ga0466719_043916 | 3300042606 | Bacteria | 13096 |
| 32 | Ga0466705_143850 | 3300042612 | Bacteria | 38978 |
| 33 | Ga0123353_10680395 | 3300010167 | Bacteria | 1449 |
| 34 | Ga0123354_10063593 | 3300010882 | Bacteria | 5421 |
| 35 | Ga0123354_10108823 | 3300010882 | Bacteria | 3677 |
| 36 | Ga0466705_404261 | 3300042612 | Bacteria | 34067 |
| 37 | Ga0466711_033361 | 3300042615 | Bacteria | 49617 |
| 38 | Ga0466711_068572 | 3300042615 | Bacteria | 1342 |
| 39 | Ga0466690_172738 | 3300042590 | Bacteria | 57212 |
| 40 | Ga0466696_323500 | 3300042596 | Bacteria | 24747 |
| 41 | Ga0466729_285797 | 3300042621 | Bacteria | 17692 |
| 42 | Ga0466703_150283 | 3300042636 | Bacteria | 2603 |
| 43 | Ga0466709_064196 | 3300042648 | Bacteria | 3277 |
| 44 | Ga0466727_289381 | 3300042655 | Bacteria | 2156 |
| 45 | IMNBL1DRAFT_c0005949 | 3300000062 | Bacteria | 6822 |
| 46 | IMNBL1DRAFT_c0016532 | 3300000062 | Bacteria | 3154 |
| 47 | IMNBL1DRAFT_c0026187 | 3300000062 | Bacteria | 2221 |
| 48 | JGI24702J35022_10023808 | 3300002462 | Bacteria | 3310 |
| 49 | Ga0068305_10142123 | 3300005083 | Bacteria | 2953 |
| 50 | Ga0123357_10000910 | 3300009784 | Bacteria | 30052 |
| 51 | Ga0466707_149202 | 3300042601 | Bacteria | 9070 |
| 52 | Ga0466713_056151 | 3300042602 | Bacteria | 40882 |
| 53 | Ga0466719_302570 | 3300042606 | Bacteria | 1001 |
| 54 | Ga0466722_087839 | 3300042609 | Bacteria | 11186 |
| 55 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 56 | Ga0123353_10465929 | 3300010167 | Bacteria | 1855 |
| 57 | Ga0123354_10100820 | 3300010882 | Bacteria | 3905 |
| 58 | Ga0466711_443745 | 3300042615 | Bacteria | 25021 |
| 59 | Ga0466715_399077 | 3300042616 | Bacteria | 1891 |
| 60 | Ga0466692_123809 | 3300042591 | Bacteria | 14245 |
| 61 | Ga0466696_004662 | 3300042596 | Bacteria | 3206 |
| 62 | Ga0466696_097884 | 3300042596 | Bacteria | 16155 |
| 63 | Ga0466696_359997 | 3300042596 | Bacteria | 6409 |
| 64 | Ga0466704_055817 | 3300042643 | Bacteria | 8022 |
| 65 | Ga0466704_251609 | 3300042643 | Bacteria | 45182 |
| 66 | Ga0466704_492381 | 3300042643 | Bacteria | 59499 |
| 67 | Ga0466709_013032 | 3300042648 | Bacteria | 7245 |
| 68 | Ga0466709_067104 | 3300042648 | Bacteria | 2016 |
| 69 | Ga0466708_464448 | 3300042652 | Bacteria | 8345 |
| 70 | JGI24702J35022_10000743 | 3300002462 | Bacteria | 20084 |
| 71 | Ga0466706_093477 | 3300042599 | Bacteria | 5278 |
| 72 | Ga0466707_189353 | 3300042601 | Bacteria | 19637 |
| 73 | Ga0466707_336627 | 3300042601 | Bacteria | 2618 |
| 74 | Ga0466716_041216 | 3300042605 | Bacteria | 5636 |
| 75 | Ga0466722_005250 | 3300042609 | Bacteria | 14032 |
| 76 | Ga0466705_113440 | 3300042612 | Bacteria | 2972 |
| 77 | Ga0466705_117307 | 3300042612 | Bacteria | 31530 |
| 78 | Ga0466733_178171 | 3300042659 | Bacteria | 1859 |
| 79 | Ga0466733_190063 | 3300042659 | Bacteria | 4972 |
| 80 | Ga0123355_11240080 | 3300009826 | Bacteria | 756 |
| 81 | Ga0123353_10060382 | 3300010167 | Bacteria | 6080 |
| 82 | Ga0123353_10111340 | 3300010167 | Bacteria | 4409 |
| 83 | Ga0123353_10935848 | 3300010167 | Bacteria | 1174 |
| 84 | Ga0123353_11396259 | 3300010167 | Bacteria | 901 |
| 85 | Ga0123354_10234880 | 3300010882 | Unclassified | 1905 |
| 86 | Ga0466711_081869 | 3300042615 | Bacteria | 19763 |
| 87 | Ga0466715_484239 | 3300042616 | Bacteria | 11010 |
| 88 | Ga0466726_068286 | 3300042619 | Bacteria | 7520 |
| 89 | Ga0466729_060358 | 3300042621 | Bacteria | 13859 |
| 90 | Ga0466690_145016 | 3300042590 | Bacteria | 9974 |
| 91 | Ga0466691_187837 | 3300042593 | Bacteria | 10413 |
| 92 | Ga0466696_071660 | 3300042596 | Bacteria | 2928 |
| 93 | Ga0466735_022154 | 3300042624 | Bacteria | 5257 |
| 94 | Ga0466703_098605 | 3300042636 | Bacteria | 6901 |
| 95 | Ga0068305_10007404 | 3300005083 | Bacteria | 89340 |
| 96 | Ga0104045_1026129 | 3300007085 | Bacteria | 7628 |
| 97 | Ga0466706_029313 | 3300042599 | Bacteria | 3370 |
| 98 | Ga0466713_117267 | 3300042602 | Bacteria | 44157 |
| 99 | Ga0466714_115350 | 3300042603 | Bacteria | 92077 |
| 100 | Ga0466717_216363 | 3300042604 | Bacteria | 5368 |
| 101 | Ga0466705_301331 | 3300042612 | Bacteria | 7209 |
| 102 | Ga0123357_10036470 | 3300009784 | Bacteria | 6691 |
| 103 | Ga0123353_10521325 | 3300010167 | Bacteria | 1724 |
| 104 | Ga0466710_341213 | 3300042613 | Bacteria | 2517 |
| 105 | Ga0466715_150159 | 3300042616 | Bacteria | 4816 |
| 106 | Ga0466726_142845 | 3300042619 | Bacteria | 1364 |
| 107 | Ga0466690_038698 | 3300042590 | Bacteria | 19777 |
| 108 | Ga0466735_051290 | 3300042624 | Bacteria | 3660 |
| 109 | Ga0466703_075697 | 3300042636 | Bacteria | 9217 |
| 110 | 2227280803 | 2225789004 | Bacteria | 6812 |
| 111 | Ga0068305_10372723 | 3300005083 | Bacteria | 1134 |
| 112 | Ga0466707_312347 | 3300042601 | Bacteria | 2770 |
| 113 | Ga0466698_488051 | 3300042610 | Bacteria | 2021 |
| 114 | Ga0466705_005241 | 3300042612 | Bacteria | 8467 |
| 115 | Ga0466733_049115 | 3300042659 | Bacteria | 2509 |
| 116 | Ga0466733_078806 | 3300042659 | Bacteria | 7143 |
| 117 | Ga0123357_10229642 | 3300009784 | Bacteria | 2037 |
| 118 | Ga0123353_10110619 | 3300010167 | Bacteria | 4426 |
| 119 | Ga0123353_11767695 | 3300010167 | Bacteria | 770 |
| 120 | Ga0123354_10008354 | 3300010882 | Bacteria | 15731 |
| 121 | Ga0123354_10024967 | 3300010882 | Bacteria | 9423 |
| 122 | Ga0466710_270337 | 3300042613 | Bacteria | 1164 |
| 123 | Ga0466711_279775 | 3300042615 | Unclassified | 1030 |
| 124 | Ga0466726_032938 | 3300042619 | Bacteria | 39699 |
| 125 | Ga0466693_269711 | 3300042592 | Bacteria | 2094 |
| 126 | Ga0466691_060692 | 3300042593 | Bacteria | 22870 |
| 127 | Ga0466735_000409 | 3300042624 | Bacteria | 5125 |
| 128 | Ga0466703_202757 | 3300042636 | Bacteria | 8523 |
| 129 | Ga0466703_233949 | 3300042636 | Bacteria | 12778 |
| 130 | Ga0466704_106814 | 3300042643 | Bacteria | 18291 |
| 131 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 132 | 2227101657 | 2225789004 | Bacteria | 1788 |
| 133 | 2227261351 | 2225789004 | Bacteria | 7006 |
| 134 | IMNBL1DRAFT_c0019925 | 3300000062 | Bacteria | 2731 |
| 135 | Ga0068305_10063851 | 3300005083 | Bacteria | 9032 |
| 136 | Ga0466706_025086 | 3300042599 | Bacteria | 7138 |
| 137 | Ga0466706_029973 | 3300042599 | Bacteria | 5825 |
| 138 | Ga0466706_156630 | 3300042599 | Bacteria | 44167 |
| 139 | Ga0466707_265281 | 3300042601 | Bacteria | 5744 |
| 140 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 141 | Ga0466722_084512 | 3300042609 | Bacteria | 5041 |
| 142 | Ga0466697_206778 | 3300042611 | Bacteria | 1925 |
| 143 | Ga0123356_10364193 | 3300010049 | Unclassified | 1574 |
| 144 | Ga0123356_12022056 | 3300010049 | Bacteria | 719 |
| 145 | Ga0466711_033752 | 3300042615 | Bacteria | 1642 |
| 146 | Ga0466715_018721 | 3300042616 | Bacteria | 59480 |
| 147 | Ga0466715_040385 | 3300042616 | Bacteria | 43736 |
| 148 | Ga0466715_337503 | 3300042616 | Bacteria | 17152 |
| 149 | Ga0466723_031578 | 3300042618 | Bacteria | 25603 |
| 150 | Ga0466693_033042 | 3300042592 | Bacteria | 1044 |
| 151 | Ga0466735_171342 | 3300042624 | Bacteria | 6348 |
| 152 | Ga0466704_388648 | 3300042643 | Bacteria | 5957 |
| 153 | IMNBL1DRAFT_c0001719 | 3300000062 | Bacteria | 16090 |
| 154 | JGI24702J35022_10008385 | 3300002462 | Bacteria | 5851 |
| 155 | Ga0068305_10025910 | 3300005083 | Unclassified | 13178 |
| 156 | Ga0072941_1497435 | 3300005201 | Bacteria | 2624 |
| 157 | Ga0104045_1002981 | 3300007085 | Bacteria | 11834 |
| 158 | Ga0466706_146517 | 3300042599 | Bacteria | 2134 |
| 159 | Ga0466713_039564 | 3300042602 | Bacteria | 1131 |
| 160 | Ga0466714_117493 | 3300042603 | Bacteria | 34193 |
| 161 | Ga0466716_429759 | 3300042605 | Bacteria | 21627 |
| 162 | Ga0466722_022507 | 3300042609 | Bacteria | 12182 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01557 | FAA_hydrolase | Fumarylacetoacetate (FAA) hydrolase family | 31 | 215 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01557 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.