Protein Family IF09128
Metagenome
Isolate
131
Members
60
Samples
113
Scaffolds
179.64
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_080625|Ga0466703_080625_14043_14648
- Length
- 201 aa
- Sequence
- MYEKSIQKHYFTENQYRHEVKKVELKGSKTEANLLTAFSGESQARNKYTFYASQARKEGYNQIADIFLETAENEKEHAKLWFKALHGGCVPETLENLKDAAAGENYEHTQMYKEFEETARKEGFSEIANQFKLVGGVEAVHEKRYLELYDSVKKCKVFKKDAVAVWKCQNCGYLHVGEEAPAVCPTCKHPQAYFEIQARNW
Sample Types
Isolate
13.7%
Metagenome
86.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.9%
Termitidae
33.9%
Kalotermitidae
16.9%
Passalidae
5.1%
Rhinotermitidae
5.1%
Termopsidae
3.4%
Hodotermitidae
1.7%
Taxonomy
Archaea
37
Bacteria
82
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2773857677 | Methanoplasma sp. Cu122P5bin30 | Isolate | Unclassified |
| 2 | 2773857691 | Unclassified Methanomassiliicoccaceae Nt197P4bin4 | Isolate | Unclassified |
| 3 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 4 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 5 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 8 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 9 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 10 | 2820159668 | Unclassified Proteobacteria Cu122P3bin5 | Isolate | Unclassified |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 15 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 16 | 2773857681 | Unclassified Methanomassiliicoccaceae Lab288P1bin114 | Isolate | Unclassified |
| 17 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 26 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 27 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2773857679 | Unclassified Methanomassiliicoccaceae Cu122P4bin8 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 2773857696 | Unclassified Methanomassiliicoccaceae Th196P4bin4 | Isolate | Unclassified |
| 42 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2773857684 | Unclassified Methanomassiliicoccaceae Lab288P3bin64 | Isolate | Unclassified |
| 45 | 2773857692 | Unclassified Methanomassiliicoccaceae Th196P3bin2 | Isolate | Unclassified |
| 46 | 2820217359 | Unclassified Kiritimatiellaeota Nt197P3bin101 | Isolate | Unclassified |
| 47 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 2773857678 | Unclassified Methanomassiliicoccaceae Co191P4bin17 | Isolate | Unclassified |
| 52 | 2608642196 | Candidatus Methanoplasma termitum MpT1 | Isolate | Unclassified |
| 53 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_11242461 | 3300010049 | Bacteria | 910 |
| 2 | Ga0123356_11561128 | 3300010049 | Bacteria | 816 |
| 3 | Ga0123353_10232186 | 3300010167 | Bacteria | 2875 |
| 4 | Ga0466735_107664 | 3300042624 | Archaea | 4376 |
| 5 | Ga0466709_027782 | 3300042648 | Bacteria | 69585 |
| 6 | Ga0415639_038900 | 3300038395 | Bacteria | 14036 |
| 7 | Ga0466695_050954 | 3300042595 | Unclassified | 1665 |
| 8 | Ga0466696_138105 | 3300042596 | Bacteria | 2088 |
| 9 | Ga0466696_196787 | 3300042596 | Bacteria | 1311 |
| 10 | IMNBL1DRAFT_c0000557 | 3300000062 | Unclassified | 30168 |
| 11 | Ga0466700_357464 | 3300042600 | Bacteria | 2674 |
| 12 | Ga0123356_10379346 | 3300010049 | Bacteria | 1546 |
| 13 | Ga0123356_12234750 | 3300010049 | Bacteria | 684 |
| 14 | Ga0123353_10084567 | 3300010167 | Archaea | 5108 |
| 15 | Ga0123354_10319654 | 3300010882 | Archaea | 1435 |
| 16 | Ga0466734_169449 | 3300042623 | Bacteria | 3490 |
| 17 | Ga0466704_079242 | 3300042643 | Bacteria | 11265 |
| 18 | Ga0466718_124832 | 3300042617 | Archaea | 6198 |
| 19 | Ga0415639_022288 | 3300038395 | Bacteria | 3976 |
| 20 | 2227544065 | 2225789004 | Unclassified | 15501 |
| 21 | IMNBL1DRAFT_c0000196 | 3300000062 | Archaea | 52932 |
| 22 | Ga0072941_1100209 | 3300005201 | Bacteria | 8152 |
| 23 | Ga0466707_013109 | 3300042601 | Archaea | 82961 |
| 24 | Ga0123357_10232753 | 3300009784 | Archaea | 2015 |
| 25 | Ga0123355_10000913 | 3300009826 | Bacteria | 40903 |
| 26 | Ga0123355_10862418 | 3300009826 | Bacteria | 993 |
| 27 | Ga0123356_10005969 | 3300010049 | Bacteria | 12361 |
| 28 | Ga0123356_10144113 | 3300010049 | Bacteria | 2354 |
| 29 | Ga0123353_10033827 | 3300010167 | Bacteria | 7965 |
| 30 | Ga0123353_10203801 | 3300010167 | Archaea | 3109 |
| 31 | Ga0123353_10601269 | 3300010167 | Bacteria | 1572 |
| 32 | Ga0123353_10675559 | 3300010167 | Bacteria | 1456 |
| 33 | Ga0123354_10334029 | 3300010882 | Archaea | 1377 |
| 34 | Ga0415639_123057 | 3300038395 | Bacteria | 3551 |
| 35 | JGI24702J35022_10049354 | 3300002462 | Bacteria | 2241 |
| 36 | JGI24702J35022_10229381 | 3300002462 | Archaea | 1073 |
| 37 | JGI24705J35276_12238811 | 3300002504 | Bacteria | 155928 |
| 38 | JGI24696J40584_12877825 | 3300002834 | Bacteria | 1071 |
| 39 | Ga0123357_10002437 | 3300009784 | Archaea | 20748 |
| 40 | Ga0466697_181495 | 3300042611 | Bacteria | 1382 |
| 41 | Ga0466700_428364 | 3300042600 | Archaea | 1762 |
| 42 | Ga0466714_108177 | 3300042603 | Unclassified | 1056 |
| 43 | Ga0123357_10129793 | 3300009784 | Archaea | 3143 |
| 44 | Ga0123355_10012711 | 3300009826 | Bacteria | 13053 |
| 45 | Ga0123355_10085743 | 3300009826 | Bacteria | 5011 |
| 46 | Ga0123356_10162172 | 3300010049 | Bacteria | 2235 |
| 47 | Ga0123356_10259612 | 3300010049 | Bacteria | 1820 |
| 48 | Ga0123356_11624798 | 3300010049 | Bacteria | 800 |
| 49 | Ga0123353_10305457 | 3300010167 | Bacteria | 2425 |
| 50 | Ga0123353_11027716 | 3300010167 | Bacteria | 1104 |
| 51 | Ga0123353_11535171 | 3300010167 | Bacteria | 846 |
| 52 | Ga0123354_10002834 | 3300010882 | Bacteria | 23424 |
| 53 | Ga0123354_10159181 | 3300010882 | Bacteria | 2691 |
| 54 | Ga0466735_222810 | 3300042624 | Bacteria | 3070 |
| 55 | Ga0466704_256111 | 3300042643 | Bacteria | 159283 |
| 56 | Ga0415639_032197 | 3300038395 | Unclassified | 4306 |
| 57 | Ga0466692_165073 | 3300042591 | Bacteria | 238196 |
| 58 | Ga0466694_233183 | 3300042594 | Bacteria | 1147 |
| 59 | Ga0466696_059170 | 3300042596 | Unclassified | 1705 |
| 60 | IMNBL1DRAFT_c0001078 | 3300000062 | Archaea | 20979 |
| 61 | JGI24703J35330_11197721 | 3300002501 | Bacteria | 760 |
| 62 | Ga0466700_371388 | 3300042600 | Bacteria | 2524 |
| 63 | Ga0123356_10044311 | 3300010049 | Bacteria | 4142 |
| 64 | Ga0123356_10180476 | 3300010049 | Bacteria | 2132 |
| 65 | Ga0123356_10225005 | 3300010049 | Bacteria | 1936 |
| 66 | Ga0123353_10169229 | 3300010167 | Bacteria | 3470 |
| 67 | Ga0123353_10640280 | 3300010167 | Bacteria | 1508 |
| 68 | Ga0466734_143940 | 3300042623 | Bacteria | 5812 |
| 69 | Ga0466703_080625 | 3300042636 | Archaea | 35770 |
| 70 | Ga0466704_068621 | 3300042643 | Unclassified | 1240 |
| 71 | Ga0466711_208002 | 3300042615 | Bacteria | 4923 |
| 72 | Ga0415639_016592 | 3300038395 | Bacteria | 15296 |
| 73 | Ga0466693_404309 | 3300042592 | Archaea | 11175 |
| 74 | Ga0466691_042014 | 3300042593 | Bacteria | 7649 |
| 75 | Ga0466691_095713 | 3300042593 | Bacteria | 3784 |
| 76 | 2227247456 | 2225789004 | Unclassified | 31874 |
| 77 | JGI24705J35276_12238268 | 3300002504 | Archaea | 18303 |
| 78 | Ga0466697_228395 | 3300042611 | Bacteria | 1561 |
| 79 | Ga0466705_353265 | 3300042612 | Bacteria | 27075 |
| 80 | Ga0466707_068292 | 3300042601 | Unclassified | 1030 |
| 81 | Ga0466714_135636 | 3300042603 | Archaea | 2039 |
| 82 | Ga0123355_10133296 | 3300009826 | Bacteria | 3822 |
| 83 | Ga0123356_10023528 | 3300010049 | Bacteria | 5796 |
| 84 | Ga0123356_10138577 | 3300010049 | Bacteria | 2397 |
| 85 | Ga0123356_10971313 | 3300010049 | Unclassified | 1020 |
| 86 | Ga0123353_10464442 | 3300010167 | Bacteria | 1859 |
| 87 | Ga0123353_11131983 | 3300010167 | Bacteria | 1035 |
| 88 | Ga0466731_014040 | 3300042622 | Archaea | 1789 |
| 89 | Ga0466735_150629 | 3300042624 | Bacteria | 3907 |
| 90 | Ga0466727_271988 | 3300042655 | Bacteria | 39865 |
| 91 | JGI24702J35022_10157988 | 3300002462 | Archaea | 1275 |
| 92 | Ga0123357_10002942 | 3300009784 | Archaea | 19248 |
| 93 | Ga0466706_188683 | 3300042599 | Bacteria | 1467 |
| 94 | Ga0466707_235250 | 3300042601 | Bacteria | 1948 |
| 95 | Ga0466716_286925 | 3300042605 | Bacteria | 11915 |
| 96 | Ga0466722_062688 | 3300042609 | Bacteria | 114214 |
| 97 | Ga0466698_035159 | 3300042610 | Archaea | 3780 |
| 98 | Ga0123355_10838836 | 3300009826 | Bacteria | 1014 |
| 99 | Ga0123356_11011414 | 3300010049 | Unclassified | 1001 |
| 100 | Ga0123353_10188379 | 3300010167 | Archaea | 3259 |
| 101 | 2226980352 | 2225789003 | Archaea | 83996 |
| 102 | JGI24696J40584_12961617 | 3300002834 | Archaea | 24505 |
| 103 | Ga0068305_10350297 | 3300005083 | Bacteria | 1968 |
| 104 | Ga0466697_088789 | 3300042611 | Archaea | 4442 |
| 105 | Ga0466719_194840 | 3300042606 | Bacteria | 1000 |
| 106 | Ga0123355_10002328 | 3300009826 | Bacteria | 26827 |
| 107 | Ga0123355_10789827 | 3300009826 | Bacteria | 1062 |
| 108 | Ga0123356_10149292 | 3300010049 | Bacteria | 2318 |
| 109 | Ga0466729_215909 | 3300042621 | Bacteria | 8672 |
| 110 | Ga0466715_396162 | 3300042616 | Bacteria | 14379 |
| 111 | 2227557947 | 2225789004 | Unclassified | 14722 |
| 112 | IMNBL1DRAFT_c0000001 | 3300000062 | Archaea | 477011 |
| 113 | JGI24702J35022_10004741 | 3300002462 | Archaea | 8048 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.