Protein Family IF09126

Metagenome Isolate
111 Members
31 Samples
101 Scaffolds
286.72 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_076733|Ga0466703_076733_13685_14611
Length
308 aa
Sequence
MHNYTSTSWGIVIVKVFDRKKGVEYQEDQMSSGGLAFLYNTVLGRFICKLLIKRPCSKVAEKYNSSKFSSRKIKAFIQRYNINMREFEKQEYGSFQAFFTRKATNSARKISSIKTDLVSPADSKLLVYQIDENASTNLGLRIKGSFYTIGELVGDNQLAQDFRNGTALVFRLTPDDYHRYIFFDDGQQLMTKEIDGILHTVTPIATSKYKVFSQNYRVVSMFRTKNFKNAIQVEVGALMVGKINNNSLSNSSGEFSRGQEKGYFEFGGSTIILLLQENAAVIDEDIKEFSNKGIEVKVRLGEKIGVKH

📊 Sample Types

Isolate 8.1%
Metagenome 91.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.3%
Unclassified 33.3%
Kalotermitidae 10.0%
Hodotermitidae 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
5 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
13 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
14 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
18 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
19 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
20 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
21 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
22 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
31 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_001746 3300038395 Bacteria 2799
2 Ga0415639_040689 3300038395 Bacteria 15854
3 Ga0415639_066663 3300038395 Bacteria 3270
4 JGI24695J34938_10002552 3300002450 Bacteria 13743
5 Ga0072940_1034124 3300005200 Bacteria 8907
6 Ga0074263_100873 3300005485 Bacteria 1542
7 Ga0123356_10038356 3300010049 Bacteria 4465
8 Ga0123356_10178478 3300010049 Bacteria 2143
9 Ga0123356_10447601 3300010049 Bacteria 1439
10 Ga0123353_10003710 3300010167 Bacteria 19417
11 Ga0123353_10671674 3300010167 Bacteria 1461
12 Ga0123353_10819606 3300010167 Bacteria 1281
13 Ga0123353_11043719 3300010167 Bacteria 1093
14 Ga0415639_005550 3300038395 Bacteria 21706
15 Ga0415639_079014 3300038395 Bacteria 1905
16 Ga0415639_116981 3300038395 Bacteria 1413
17 Ga0466720_040267 3300042607 Bacteria 18018
18 Ga0466703_076733 3300042636 Bacteria 34760
19 Ga0123356_10004665 3300010049 Bacteria 14122
20 Ga0123356_10039135 3300010049 Bacteria 4418
21 Ga0123356_10061836 3300010049 Unclassified 3497
22 Ga0123356_10132727 3300010049 Bacteria 2443
23 Ga0123353_10767120 3300010167 Bacteria 1339
24 Ga0466699_107974 3300042597 Bacteria 7101
25 Ga0123356_10013069 3300010049 Bacteria 8030
26 Ga0123356_10020043 3300010049 Bacteria 6333
27 Ga0123356_10039950 3300010049 Bacteria 4371
28 Ga0123356_10155116 3300010049 Bacteria 2279
29 Ga0123356_10186124 3300010049 Bacteria 2103
30 Ga0123356_10379607 3300010049 Bacteria 1545
31 Ga0123356_10566663 3300010049 Bacteria 1298
32 Ga0123356_10902135 3300010049 Bacteria 1055
33 Ga0123353_10005367 3300010167 Bacteria 16798
34 Ga0123353_10026087 3300010167 Bacteria 8915
35 Ga0123353_10118682 3300010167 Bacteria 4254
36 Ga0123353_10510899 3300010167 Bacteria 1747
37 Ga0466718_094162 3300042617 Bacteria 9073
38 Ga0415639_186771 3300038395 Bacteria 3955
39 Ga0123356_10004794 3300010049 Bacteria 13918
40 Ga0123356_10005570 3300010049 Bacteria 12808
41 Ga0123356_10249930 3300010049 Bacteria 1850
42 Ga0123353_10041195 3300010167 Bacteria 7293
43 Ga0123353_10926893 3300010167 Bacteria 1182
44 Ga0123354_10239903 3300010882 Unclassified 1868
45 Ga0466707_090430 3300042601 Bacteria 21696
46 Ga0466720_064529 3300042607 Bacteria 17314
47 AustNasuHG_c1000221 3300000089 Bacteria 19027
48 Ga0466731_014881 3300042622 Bacteria 7131
49 Ga0466731_437083 3300042622 Bacteria 6081
50 Ga0123355_10263798 3300009826 Bacteria 2404
51 Ga0123356_10001475 3300010049 Bacteria 25935
52 Ga0123356_10002690 3300010049 Bacteria 18869
53 Ga0123356_10010140 3300010049 Bacteria 9265
54 Ga0123356_10019062 3300010049 Bacteria 6506
55 Ga0123356_10139990 3300010049 Bacteria 2386
56 Ga0123356_10179700 3300010049 Bacteria 2136
57 Ga0123356_10552630 3300010049 Bacteria 1312
58 Ga0123353_10199922 3300010167 Bacteria 3145
59 Ga0123353_10605865 3300010167 Bacteria 1564
60 Ga0466732_283297 3300042656 Bacteria 5836
61 Ga0264413_104235 3300024493 Bacteria 8345
62 Ga0415639_001414 3300038395 Bacteria 18045
63 Ga0466696_259188 3300042596 Bacteria 2426
64 Ga0466706_288762 3300042599 Bacteria 23994
65 Ga0123355_10005047 3300009826 Bacteria 19233
66 Ga0123356_10007388 3300010049 Bacteria 10962
67 Ga0123356_10013485 3300010049 Bacteria 7884
68 Ga0123356_10018160 3300010049 Bacteria 6679
69 Ga0123356_10064871 3300010049 Bacteria 3415
70 Ga0123356_10141045 3300010049 Bacteria 2377
71 Ga0123356_10234746 3300010049 Bacteria 1901
72 Ga0123356_10344066 3300010049 Bacteria 1613
73 Ga0123356_10908734 3300010049 Bacteria 1052
74 Ga0123353_10021821 3300010167 Bacteria 9624
75 Ga0123353_10141131 3300010167 Bacteria 3859
76 Ga0123353_10181137 3300010167 Bacteria 3335
77 Ga0123353_10357027 3300010167 Bacteria 2198
78 Ga0123353_10814207 3300010167 Bacteria 1287
79 Ga0466732_345256 3300042656 Bacteria 21012
80 Ga0466700_091745 3300042600 Bacteria 5795
81 Ga0466720_159683 3300042607 Unclassified 18768
82 Ga0466721_131934 3300042608 Bacteria 1514
83 JGI24695J34938_10007566 3300002450 Bacteria 6331
84 Ga0072940_1112888 3300005200 Bacteria 6164
85 Ga0123356_10001498 3300010049 Bacteria 25683
86 Ga0123356_10003114 3300010049 Bacteria 17505
87 Ga0123356_10029142 3300010049 Bacteria 5170
88 Ga0123356_10050601 3300010049 Bacteria 3866
89 Ga0123356_10139540 3300010049 Bacteria 2389
90 Ga0123356_10534187 3300010049 Bacteria 1332
91 Ga0123356_10821433 3300010049 Bacteria 1101
92 Ga0123353_10000753 3300010167 Bacteria 39300
93 Ga0123353_10191130 3300010167 Bacteria 3231
94 Ga0123353_10224786 3300010167 Bacteria 2932
95 Ga0123353_10432230 3300010167 Bacteria 1946
96 Ga0466708_421862 3300042652 Bacteria 102077
97 Ga0123356_10020618 3300010049 Bacteria 6233
98 Ga0123356_10092217 3300010049 Bacteria 2889
99 Ga0123356_10116165 3300010049 Bacteria 2594
100 Ga0123353_10814902 3300010167 Bacteria 1286
101 Ga0466732_173525 3300042656 Bacteria 1043

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 95 305 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.