Protein Family IF09112

Metagenome Isolate
142 Members
55 Samples
123 Scaffolds
305.22 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_052440|Ga0466703_052440_200_1231
Length
343 aa
Sequence
MKTSDRRETEKLPAHFFCLFFVSGETFYLHLRLQEPIIMLKKSLVSIDQCTKEDILRIIGNAKKFEENPDRNLLAGKVAATLFFEPSTRTRLSFETAVNRLGGRVVGFQDASTTSSSKGETLKDTILMVSNYVDIIIMRHYLEGAARYASEVTDIPVINAGDGANQHPSQTLLDLYSIKKTQGGLDGLTITMVGDLKYGRTVHSLIVGMSHFSPKFHFIAPDELKMPDEQKRFCQLHGIEFHEHAVFSEDIIAETDILYMTRVQKERFTDLVEYERVKNVYILHNKMLENSKSNLRVLHPLPRVNEIAYDVDDNPKAYYIQQARNGLFTREAIICDVLGIICN

📊 Sample Types

Isolate 13.4%
Metagenome 86.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 34.5%
Kalotermitidae 25.5%
Termitidae 20.0%
Termopsidae 7.3%
Unclassified 5.5%
Rhinotermitidae 3.6%
Passalidae 1.8%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
4 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
5 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
6 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
7 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
8 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
9 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
10 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
11 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
14 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
15 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
16 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
17 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
18 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
19 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 2923982719 Parabacteroides sp. 52 Isolate Blattidae
33 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
34 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
35 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
40 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
45 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
46 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
47 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
48 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
49 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
50 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
51 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
52 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_022136 3300042612 Bacteria 7133
2 Ga0466706_111085 3300042599 Bacteria 3417
3 Ga0466700_334631 3300042600 Bacteria 1311
4 Ga0466713_064514 3300042602 Unclassified 13161
5 Ga0466716_051729 3300042605 Bacteria 13840
6 Ga0466722_075834 3300042609 Bacteria 10831
7 Ga0068305_10077163 3300005083 Unclassified 10841
8 Ga0466723_312949 3300042618 Bacteria 6558
9 Ga0466728_016517 3300042620 Bacteria 38293
10 Ga0466731_426610 3300042622 Bacteria 2873
11 Ga0466703_038209 3300042636 Bacteria 5328
12 Ga0466704_181382 3300042643 Bacteria 6518
13 Ga0466725_047035 3300042654 Bacteria 4938
14 Ga0466656_248118 3300042550 Bacteria 1725
15 Ga0466690_006915 3300042590 Bacteria 5192
16 Ga0466691_035615 3300042593 Bacteria 6377
17 Ga0466691_087899 3300042593 Bacteria 15107
18 Ga0466696_324982 3300042596 Bacteria 3450
19 Ga0123353_10069135 3300010167 Bacteria 5673
20 Ga0068305_10055507 3300005083 Bacteria 8481
21 Ga0068305_10055564 3300005083 Bacteria 18731
22 Ga0466715_188075 3300042616 Bacteria 87062
23 Ga0466726_219661 3300042619 Bacteria 8480
24 Ga0466729_031103 3300042621 Bacteria 19143
25 Ga0466735_031150 3300042624 Unclassified 3024
26 Ga0466735_223644 3300042624 Bacteria 2675
27 Ga0466703_274572 3300042636 Bacteria 12534
28 Ga0466707_025476 3300042601 Bacteria 9966
29 Ga0466716_036664 3300042605 Bacteria 4367
30 Ga0466719_059375 3300042606 Bacteria 2004
31 Ga0466719_122038 3300042606 Bacteria 8102
32 Ga0466722_001372 3300042609 Bacteria 7070
33 Ga0466722_017922 3300042609 Bacteria 50732
34 Ga0068305_10091325 3300005083 Bacteria 15766
35 Ga0466715_261346 3300042616 Bacteria 28761
36 Ga0466715_381051 3300042616 Bacteria 5747
37 Ga0466723_120993 3300042618 Bacteria 29616
38 Ga0466728_360782 3300042620 Bacteria 37454
39 Ga0466703_121914 3300042636 Unclassified 5386
40 Ga0466703_256155 3300042636 Unclassified 8293
41 Ga0466708_293328 3300042652 Bacteria 56768
42 Ga0466727_282938 3300042655 Bacteria 7344
43 Ga0466691_138795 3300042593 Bacteria 7312
44 Ga0466696_295020 3300042596 Bacteria 31908
45 Ga0466733_006417 3300042659 Bacteria 20786
46 Ga0466713_033740 3300042602 Bacteria 18936
47 Ga0466719_064486 3300042606 Bacteria 19424
48 Ga0068302_10229902 3300005071 Bacteria 4786
49 Ga0068305_10083417 3300005083 Bacteria 20277
50 Ga0466712_313568 3300042614 Bacteria 1982
51 Ga0466711_318661 3300042615 Bacteria 2722
52 Ga0466715_157292 3300042616 Bacteria 5418
53 Ga0466715_343665 3300042616 Bacteria 20123
54 Ga0466718_038049 3300042617 Bacteria 1627
55 Ga0466726_410456 3300042619 Unclassified 1415
56 Ga0466704_397285 3300042643 Bacteria 2842
57 Ga0466709_193369 3300042648 Bacteria 7409
58 Ga0466709_199995 3300042648 Bacteria 19280
59 Ga0466727_223410 3300042655 Bacteria 5802
60 Ga0466696_074655 3300042596 Bacteria 12961
61 Ga0466713_152634 3300042602 Bacteria 19458
62 JGI24702J35022_10002383 3300002462 Bacteria 11499
63 JGI24702J35022_10050145 3300002462 Bacteria 2223
64 Ga0466715_120257 3300042616 Bacteria 34712
65 Ga0466723_120929 3300042618 Bacteria 26730
66 Ga0466735_027786 3300042624 Bacteria 3369
67 Ga0466727_179063 3300042655 Bacteria 8325
68 Ga0466696_157739 3300042596 Bacteria 23273
69 Ga0466733_144405 3300042659 Bacteria 17873
70 Ga0123356_10196738 3300010049 Bacteria 2052
71 Ga0466707_135192 3300042601 Bacteria 4884
72 Ga0466713_010763 3300042602 Bacteria 24879
73 Ga0466716_223439 3300042605 Bacteria 4893
74 Ga0466719_215929 3300042606 Bacteria 11551
75 Ga0466719_564922 3300042606 Unclassified 3557
76 IMNBL1DRAFT_c0000766 3300000062 Bacteria 25390
77 JGI24702J35022_10016202 3300002462 Bacteria 4088
78 Ga0068305_10459535 3300005083 Bacteria 1043
79 Ga0466705_418678 3300042612 Bacteria 18793
80 Ga0466710_229280 3300042613 Bacteria 5222
81 Ga0466711_009358 3300042615 Bacteria 8515
82 Ga0466711_386510 3300042615 Bacteria 4599
83 Ga0466723_068728 3300042618 Bacteria 7140
84 Ga0466728_003769 3300042620 Bacteria 38145
85 Ga0466703_320358 3300042636 Bacteria 44545
86 Ga0466704_093070 3300042643 Bacteria 10098
87 Ga0466704_150058 3300042643 Unclassified 2826
88 Ga0466704_596308 3300042643 Unclassified 5305
89 Ga0466727_207748 3300042655 Bacteria 4836
90 Ga0466690_017646 3300042590 Bacteria 34395
91 Ga0466696_343468 3300042596 Bacteria 1953
92 Ga0466707_171999 3300042601 Bacteria 4800
93 Ga0466707_282031 3300042601 Bacteria 1482
94 Ga0466713_036562 3300042602 Bacteria 10121
95 Ga0466713_061789 3300042602 Bacteria 88378
96 Ga0466711_041848 3300042615 Bacteria 64215
97 Ga0466711_090418 3300042615 Bacteria 23657
98 Ga0466715_364861 3300042616 Bacteria 4999
99 Ga0466723_036926 3300042618 Bacteria 32420
100 Ga0466723_220137 3300042618 Unclassified 1943
101 Ga0466728_410478 3300042620 Bacteria 6378
102 Ga0466703_052440 3300042636 Bacteria 4599
103 Ga0466703_200042 3300042636 Bacteria 11528
104 Ga0466704_085150 3300042643 Bacteria 8273
105 Ga0466704_104989 3300042643 Bacteria 11862
106 Ga0466656_352580 3300042550 Bacteria 10661
107 Ga0466691_077113 3300042593 Bacteria 29256
108 Ga0466696_213083 3300042596 Bacteria 6950
109 Ga0466696_324676 3300042596 Bacteria 3117
110 Ga0466696_380396 3300042596 Bacteria 4691
111 Ga0466705_140360 3300042612 Bacteria 13000
112 Ga0466705_169781 3300042612 Bacteria 18950
113 Ga0466706_175020 3300042599 Bacteria 3483
114 Ga0466713_011874 3300042602 Bacteria 11655
115 JGI24702J35022_10000687 3300002462 Bacteria 20622
116 Ga0466710_279467 3300042613 Bacteria 2035
117 Ga0466711_182217 3300042615 Bacteria 7158
118 Ga0466728_337764 3300042620 Bacteria 49516
119 Ga0466709_365428 3300042648 Bacteria 8404
120 Ga0466727_258950 3300042655 Bacteria 9320
121 Ga0466690_058831 3300042590 Unclassified 4449
122 Ga0466690_411604 3300042590 Bacteria 10208
123 Ga0466696_135989 3300042596 Bacteria 2130

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 42 179 0.92
PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 186 335 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.