Protein Family IF09106
Metagenome
Isolate
162
Members
55
Samples
158
Scaffolds
333.19
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_041834|Ga0466703_041834_7195_8247
- Length
- 350 aa
- Sequence
- MKPFEHKPAAHCETGVTANLLNFHGIKISEPMALGLGAGLFFSHMPFVTLHGMAVTSFRPLPGQIFSRVTKALGVKVKKRRFLNRDRSMRALDGLLARGLPAGVLVGVFHLPYFPKEYRFHFNAHNIAVTGKENGRYIISDPVLMHKETIGYEALKRCRYAKGTYPPYGKMYWIDRVKTQHPDLPRAIVHAIKLNCRRMLDIPVPFFGVRGIGMLAKRMRRWEQRFGSGRAALNLAQIVRMLEEIGTGGAGFRFMYAAFLQEAAGILGNPAFKTHALRMTEAGDRWRDFAAEAGRKFKNRGENICSYDELADKLVKIAGMEEALFRALRRAVKEYKQQPPQHSKTPCKPQ
Sample Types
Isolate
0.6%
Metagenome
99.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.3%
Kalotermitidae
25.9%
Unclassified
7.4%
Termopsidae
7.4%
Rhinotermitidae
5.6%
Passalidae
3.7%
Armadillidiidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
1
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 53 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 54 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_065829 | 3300042612 | Bacteria | 3495 |
| 2 | Ga0466705_093546 | 3300042612 | Bacteria | 7799 |
| 3 | Ga0466733_175448 | 3300042659 | Bacteria | 12342 |
| 4 | Ga0466690_027984 | 3300042590 | Bacteria | 22404 |
| 5 | Ga0466693_227636 | 3300042592 | Bacteria | 1655 |
| 6 | Ga0466691_036704 | 3300042593 | Bacteria | 9460 |
| 7 | Ga0466695_025004 | 3300042595 | Bacteria | 3391 |
| 8 | Ga0466696_360550 | 3300042596 | Bacteria | 3559 |
| 9 | 2227569084 | 2225789004 | Unclassified | 13975 |
| 10 | Ga0068305_10034324 | 3300005083 | Unclassified | 5220 |
| 11 | Ga0466711_267178 | 3300042615 | Bacteria | 15544 |
| 12 | Ga0466715_105923 | 3300042616 | Bacteria | 7238 |
| 13 | Ga0466718_106005 | 3300042617 | Bacteria | 3962 |
| 14 | Ga0466723_104160 | 3300042618 | Bacteria | 7219 |
| 15 | Ga0466700_122917 | 3300042600 | Bacteria | 6223 |
| 16 | Ga0466707_008476 | 3300042601 | Bacteria | 6446 |
| 17 | Ga0466704_055265 | 3300042643 | Bacteria | 9181 |
| 18 | Ga0466704_229067 | 3300042643 | Bacteria | 5654 |
| 19 | Ga0466704_233148 | 3300042643 | Bacteria | 8550 |
| 20 | Ga0466704_579813 | 3300042643 | Bacteria | 6665 |
| 21 | Ga0466727_320916 | 3300042655 | Bacteria | 11022 |
| 22 | Ga0466705_328630 | 3300042612 | Bacteria | 11290 |
| 23 | Ga0466690_345339 | 3300042590 | Bacteria | 11200 |
| 24 | Ga0466690_425328 | 3300042590 | Bacteria | 20328 |
| 25 | Ga0466692_018883 | 3300042591 | Bacteria | 11741 |
| 26 | Ga0123353_10178352 | 3300010167 | Bacteria | 3366 |
| 27 | Ga0068305_10046749 | 3300005083 | Bacteria | 15173 |
| 28 | Ga0466711_033361 | 3300042615 | Bacteria | 49617 |
| 29 | Ga0466715_093845 | 3300042616 | Bacteria | 8607 |
| 30 | Ga0466726_079241 | 3300042619 | Bacteria | 3800 |
| 31 | Ga0466729_037321 | 3300042621 | Bacteria | 9309 |
| 32 | Ga0466713_106609 | 3300042602 | Bacteria | 5617 |
| 33 | Ga0466713_144989 | 3300042602 | Bacteria | 26601 |
| 34 | Ga0466717_110569 | 3300042604 | Bacteria | 1690 |
| 35 | Ga0466716_128812 | 3300042605 | Bacteria | 10247 |
| 36 | Ga0466729_242331 | 3300042621 | Bacteria | 6461 |
| 37 | Ga0466731_393413 | 3300042622 | Bacteria | 2016 |
| 38 | Ga0466704_412312 | 3300042643 | Bacteria | 7914 |
| 39 | Ga0466727_095699 | 3300042655 | Bacteria | 5417 |
| 40 | Ga0466727_314555 | 3300042655 | Bacteria | 21280 |
| 41 | Ga0466693_413922 | 3300042592 | Bacteria | 3633 |
| 42 | Ga0466695_030357 | 3300042595 | Bacteria | 1901 |
| 43 | Ga0123353_10015856 | 3300010167 | Bacteria | 10976 |
| 44 | Ga0123353_10043679 | 3300010167 | Bacteria | 7102 |
| 45 | IMNBL1DRAFT_c0041622 | 3300000062 | Bacteria | 1540 |
| 46 | JGI24702J35022_10002898 | 3300002462 | Bacteria | 10390 |
| 47 | JGI24702J35022_10048816 | 3300002462 | Bacteria | 2254 |
| 48 | Ga0068302_10257081 | 3300005071 | Bacteria | 2504 |
| 49 | Ga0466728_420456 | 3300042620 | Bacteria | 14778 |
| 50 | Ga0466719_474009 | 3300042606 | Bacteria | 3681 |
| 51 | Ga0466722_012804 | 3300042609 | Bacteria | 32142 |
| 52 | Ga0466722_021911 | 3300042609 | Bacteria | 53346 |
| 53 | Ga0466722_048122 | 3300042609 | Bacteria | 7954 |
| 54 | Ga0466735_010465 | 3300042624 | Bacteria | 4260 |
| 55 | Ga0466703_300583 | 3300042636 | Bacteria | 9814 |
| 56 | Ga0466704_523022 | 3300042643 | Bacteria | 38563 |
| 57 | Ga0466725_367336 | 3300042654 | Bacteria | 12007 |
| 58 | Ga0466727_029822 | 3300042655 | Bacteria | 1353 |
| 59 | Ga0466697_243490 | 3300042611 | Bacteria | 2053 |
| 60 | Ga0466656_312475 | 3300042550 | Bacteria | 8289 |
| 61 | Ga0466696_100857 | 3300042596 | Bacteria | 5054 |
| 62 | Ga0466699_115621 | 3300042597 | Bacteria | 3399 |
| 63 | Ga0123357_10009310 | 3300009784 | Bacteria | 12384 |
| 64 | Ga0123353_10069561 | 3300010167 | Bacteria | 5655 |
| 65 | Ga0123353_10283224 | 3300010167 | Bacteria | 2544 |
| 66 | Ga0123354_10002679 | 3300010882 | Bacteria | 23835 |
| 67 | JGI24698J34947_10061612 | 3300002449 | Bacteria | 1845 |
| 68 | JGI24702J35022_10041455 | 3300002462 | Bacteria | 2454 |
| 69 | JGI24696J40584_12916780 | 3300002834 | Bacteria | 1306 |
| 70 | Ga0466705_462117 | 3300042612 | Bacteria | 1282 |
| 71 | Ga0466711_271505 | 3300042615 | Bacteria | 11152 |
| 72 | Ga0466715_397728 | 3300042616 | Bacteria | 15873 |
| 73 | Ga0466726_406831 | 3300042619 | Bacteria | 6709 |
| 74 | Ga0466728_423911 | 3300042620 | Bacteria | 14870 |
| 75 | Ga0466707_208082 | 3300042601 | Bacteria | 19370 |
| 76 | Ga0466707_289715 | 3300042601 | Bacteria | 1711 |
| 77 | Ga0466707_378443 | 3300042601 | Bacteria | 2259 |
| 78 | Ga0466713_149360 | 3300042602 | Bacteria | 3548 |
| 79 | Ga0466716_162015 | 3300042605 | Bacteria | 6148 |
| 80 | Ga0466719_173028 | 3300042606 | Unclassified | 6242 |
| 81 | Ga0466719_293286 | 3300042606 | Bacteria | 11074 |
| 82 | Ga0466722_148686 | 3300042609 | Bacteria | 4081 |
| 83 | Ga0466703_405257 | 3300042636 | Bacteria | 23623 |
| 84 | Ga0466704_053654 | 3300042643 | Bacteria | 1833 |
| 85 | Ga0466709_012041 | 3300042648 | Bacteria | 17191 |
| 86 | Ga0123354_10212888 | 3300010882 | Bacteria | 2082 |
| 87 | IMNBL1DRAFT_c0004517 | 3300000062 | Bacteria | 8317 |
| 88 | JGI24696J40584_12961651 | 3300002834 | Bacteria | 28246 |
| 89 | Ga0466723_306490 | 3300042618 | Bacteria | 16637 |
| 90 | Ga0466706_205904 | 3300042599 | Bacteria | 63886 |
| 91 | Ga0466713_046573 | 3300042602 | Bacteria | 48292 |
| 92 | Ga0466714_096666 | 3300042603 | Bacteria | 172614 |
| 93 | Ga0466717_288403 | 3300042604 | Bacteria | 3178 |
| 94 | Ga0466719_093108 | 3300042606 | Bacteria | 6019 |
| 95 | Ga0466719_328042 | 3300042606 | Bacteria | 2312 |
| 96 | Ga0466698_082785 | 3300042610 | Bacteria | 2476 |
| 97 | Ga0466731_076764 | 3300042622 | Unclassified | 1126 |
| 98 | Ga0466703_226878 | 3300042636 | Bacteria | 12074 |
| 99 | Ga0466733_003794 | 3300042659 | Bacteria | 34484 |
| 100 | Ga0466692_110056 | 3300042591 | Bacteria | 56697 |
| 101 | Ga0466693_280058 | 3300042592 | Bacteria | 3355 |
| 102 | Ga0466696_384606 | 3300042596 | Bacteria | 2602 |
| 103 | Ga0123356_10006654 | 3300010049 | Bacteria | 11652 |
| 104 | Ga0123353_10074108 | 3300010167 | Bacteria | 5472 |
| 105 | JGI24705J35276_12238737 | 3300002504 | Bacteria | 48270 |
| 106 | Ga0068302_10162501 | 3300005071 | Bacteria | 9312 |
| 107 | Ga0072941_1098311 | 3300005201 | Bacteria | 2523 |
| 108 | Ga0466715_221028 | 3300042616 | Bacteria | 9872 |
| 109 | Ga0466707_069919 | 3300042601 | Bacteria | 7241 |
| 110 | Ga0466713_145995 | 3300042602 | Bacteria | 4468 |
| 111 | Ga0466717_015711 | 3300042604 | Bacteria | 1622 |
| 112 | Ga0466716_256567 | 3300042605 | Bacteria | 7977 |
| 113 | Ga0466719_113428 | 3300042606 | Bacteria | 10674 |
| 114 | Ga0466722_163672 | 3300042609 | Bacteria | 3221 |
| 115 | Ga0466722_194852 | 3300042609 | Bacteria | 7088 |
| 116 | Ga0466735_081797 | 3300042624 | Bacteria | 2645 |
| 117 | Ga0466735_182300 | 3300042624 | Bacteria | 3498 |
| 118 | Ga0466735_230171 | 3300042624 | Bacteria | 2131 |
| 119 | Ga0466703_041834 | 3300042636 | Bacteria | 15244 |
| 120 | Ga0466705_091793 | 3300042612 | Bacteria | 13283 |
| 121 | Ga0160433_100284 | 3300012846 | Bacteria | 33668 |
| 122 | Ga0466691_061439 | 3300042593 | Bacteria | 8911 |
| 123 | Ga0466691_214132 | 3300042593 | Bacteria | 39556 |
| 124 | Ga0466694_005656 | 3300042594 | Bacteria | 1298 |
| 125 | Ga0123357_10033871 | 3300009784 | Bacteria | 6941 |
| 126 | Ga0123356_10056585 | 3300010049 | Bacteria | 3654 |
| 127 | Ga0123354_10049694 | 3300010882 | Bacteria | 6358 |
| 128 | Ga0072941_1346472 | 3300005201 | Bacteria | 1564 |
| 129 | Ga0466715_631189 | 3300042616 | Archaea | 5698 |
| 130 | Ga0466706_116533 | 3300042599 | Bacteria | 1696 |
| 131 | Ga0466714_090515 | 3300042603 | Bacteria | 55724 |
| 132 | Ga0466719_190941 | 3300042606 | Bacteria | 6420 |
| 133 | Ga0466735_013652 | 3300042624 | Bacteria | 4210 |
| 134 | Ga0466703_315006 | 3300042636 | Bacteria | 6239 |
| 135 | Ga0466708_301949 | 3300042652 | Bacteria | 21510 |
| 136 | Ga0466725_174101 | 3300042654 | Bacteria | 15697 |
| 137 | Ga0466727_038193 | 3300042655 | Bacteria | 3617 |
| 138 | Ga0466733_107037 | 3300042659 | Bacteria | 20789 |
| 139 | Ga0466690_015023 | 3300042590 | Bacteria | 27335 |
| 140 | Ga0466692_079486 | 3300042591 | Bacteria | 2451 |
| 141 | Ga0466694_050280 | 3300042594 | Bacteria | 1849 |
| 142 | Ga0466696_228385 | 3300042596 | Bacteria | 15316 |
| 143 | Ga0466696_293216 | 3300042596 | Bacteria | 5613 |
| 144 | Ga0123354_10312600 | 3300010882 | Bacteria | 1464 |
| 145 | JGI24702J35022_10044507 | 3300002462 | Bacteria | 2366 |
| 146 | Ga0068302_10087038 | 3300005071 | Bacteria | 10777 |
| 147 | Ga0072940_1017528 | 3300005200 | Bacteria | 3075 |
| 148 | Ga0072940_1095028 | 3300005200 | Bacteria | 1833 |
| 149 | Ga0466710_421903 | 3300042613 | Bacteria | 1468 |
| 150 | Ga0466715_386074 | 3300042616 | Bacteria | 6269 |
| 151 | Ga0466723_158970 | 3300042618 | Bacteria | 11645 |
| 152 | Ga0466726_176697 | 3300042619 | Bacteria | 8659 |
| 153 | Ga0466728_134156 | 3300042620 | Bacteria | 13245 |
| 154 | Ga0466716_389534 | 3300042605 | Bacteria | 7339 |
| 155 | Ga0466719_224124 | 3300042606 | Bacteria | 4643 |
| 156 | Ga0466719_422125 | 3300042606 | Bacteria | 11834 |
| 157 | Ga0466721_086981 | 3300042608 | Bacteria | 1952 |
| 158 | Ga0466708_187548 | 3300042652 | Bacteria | 6611 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.