Protein Family IF09101
Metagenome
Isolate
197
Members
72
Samples
173
Scaffolds
322.4
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_035538|Ga0466703_035538_755_1804
- Length
- 349 aa
- Sequence
- MTFIKWLPFAPIRRLVNKEKSKKNNMSETIKEPIEPFGLFSKDKKKSLFSKIGVVGAGKDGRNIIRLTSSAGLEVIFIEVNQERIDFAFERLSAGLDSRIENWGLTPNEKRAILGRIKGSTDYADLQDCDFVIECIRYDKETGERNTYLRQQAFKEIESIVLPEAIIATNSTTVIISELASVLKYKERCVSLHFPVAHPDAKILEVVKGAYTTQEVYDKVLLFAKLINYEIIEANESNGLVSMRLIVVLLNEACQMLMEKTAKMETIDRLTVVSYGMRIGIFQMADIIGIEKLVSLMEDMFNEYGDKKYKPNPILWRLYRTQQLGIPTGKGFFIYNKDGILTGPNPFFN
Sample Types
Isolate
12.2%
Metagenome
87.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.0%
Kalotermitidae
18.3%
Blattidae
16.9%
Unclassified
15.5%
Rhinotermitidae
7.0%
Termopsidae
4.2%
Passalidae
2.8%
Hydrophilidae
2.8%
Tenebrionidae
1.4%
Taxonomy
Archaea
1
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 5 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 6 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 7 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 14 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 15 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 24 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 31 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 32 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 38 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 39 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 40 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 45 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 46 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 51 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 52 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 53 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 54 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 55 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 58 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 59 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 61 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 62 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 63 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 64 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 65 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 66 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 67 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 68 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 69 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 70 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 71 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_318861 | 3300042590 | Bacteria | 7814 |
| 2 | Ga0466692_189168 | 3300042591 | Bacteria | 10793 |
| 3 | Ga0466694_313292 | 3300042594 | Bacteria | 2662 |
| 4 | Ga0466696_244582 | 3300042596 | Bacteria | 16816 |
| 5 | Ga0466701_023932 | 3300042598 | Bacteria | 3824 |
| 6 | Ga0466707_157817 | 3300042601 | Bacteria | 16055 |
| 7 | Ga0466707_165588 | 3300042601 | Bacteria | 25190 |
| 8 | Ga0466713_055139 | 3300042602 | Bacteria | 14361 |
| 9 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 10 | Ga0466716_225095 | 3300042605 | Bacteria | 6604 |
| 11 | Ga0466716_495992 | 3300042605 | Bacteria | 7025 |
| 12 | Ga0123357_10010444 | 3300009784 | Bacteria | 11814 |
| 13 | Ga0123353_10220107 | 3300010167 | Bacteria | 2969 |
| 14 | Ga0466705_422592 | 3300042612 | Bacteria | 6487 |
| 15 | Ga0466711_185820 | 3300042615 | Bacteria | 5199 |
| 16 | Ga0466723_141970 | 3300042618 | Bacteria | 8148 |
| 17 | Ga0466726_105741 | 3300042619 | Bacteria | 4244 |
| 18 | Ga0466726_287830 | 3300042619 | Bacteria | 1527 |
| 19 | Ga0466734_077536 | 3300042623 | Bacteria | 1027 |
| 20 | Ga0466730_078089 | 3300042625 | Bacteria | 2976 |
| 21 | Ga0466703_046039 | 3300042636 | Bacteria | 8932 |
| 22 | Ga0466704_556113 | 3300042643 | Bacteria | 5947 |
| 23 | Ga0466709_106408 | 3300042648 | Bacteria | 13749 |
| 24 | JGI24699J35502_11134213 | 3300002509 | Bacteria | 63023 |
| 25 | Ga0123357_10002521 | 3300009784 | Bacteria | 20500 |
| 26 | Ga0466733_022961 | 3300042659 | Bacteria | 5611 |
| 27 | Ga0466733_217896 | 3300042659 | Bacteria | 5113 |
| 28 | Ga0466657_298688 | 3300042582 | Bacteria | 2036 |
| 29 | Ga0466693_011818 | 3300042592 | Bacteria | 3507 |
| 30 | Ga0466691_159723 | 3300042593 | Bacteria | 21684 |
| 31 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 32 | Ga0466700_051947 | 3300042600 | Bacteria | 66586 |
| 33 | Ga0466700_395690 | 3300042600 | Bacteria | 2378 |
| 34 | Ga0466700_481489 | 3300042600 | Bacteria | 3375 |
| 35 | Ga0466713_077233 | 3300042602 | Bacteria | 28426 |
| 36 | Ga0466713_087028 | 3300042602 | Bacteria | 4505 |
| 37 | Ga0466713_097614 | 3300042602 | Bacteria | 86999 |
| 38 | Ga0466713_131785 | 3300042602 | Bacteria | 7984 |
| 39 | Ga0466713_135457 | 3300042602 | Bacteria | 3798 |
| 40 | Ga0466719_476930 | 3300042606 | Bacteria | 5334 |
| 41 | Ga0123357_10185727 | 3300009784 | Bacteria | 2412 |
| 42 | Ga0123355_10035574 | 3300009826 | Bacteria | 8094 |
| 43 | Ga0123354_10000857 | 3300010882 | Bacteria | 33765 |
| 44 | Ga0123354_10103359 | 3300010882 | Bacteria | 3832 |
| 45 | Ga0466735_016944 | 3300042624 | Bacteria | 4319 |
| 46 | Ga0466735_205470 | 3300042624 | Bacteria | 2091 |
| 47 | Ga0466725_404404 | 3300042654 | Bacteria | 15334 |
| 48 | JGI24699J35502_11134214 | 3300002509 | Bacteria | 63548 |
| 49 | Ga0466733_021167 | 3300042659 | Bacteria | 5191 |
| 50 | Ga0466733_146938 | 3300042659 | Bacteria | 39655 |
| 51 | Ga0466696_336751 | 3300042596 | Bacteria | 8396 |
| 52 | Ga0466707_230234 | 3300042601 | Bacteria | 4323 |
| 53 | Ga0466719_445879 | 3300042606 | Bacteria | 3449 |
| 54 | Ga0466722_051611 | 3300042609 | Bacteria | 8465 |
| 55 | Ga0466722_143739 | 3300042609 | Bacteria | 19742 |
| 56 | Ga0123357_10009271 | 3300009784 | Bacteria | 12406 |
| 57 | Ga0123357_10087305 | 3300009784 | Bacteria | 4080 |
| 58 | Ga0123357_10190841 | 3300009784 | Bacteria | 2361 |
| 59 | Ga0123354_10004244 | 3300010882 | Bacteria | 20226 |
| 60 | Ga0466712_075774 | 3300042614 | Bacteria | 1975 |
| 61 | Ga0466715_284356 | 3300042616 | Bacteria | 41147 |
| 62 | Ga0466723_289044 | 3300042618 | Bacteria | 1277 |
| 63 | Ga0466703_035538 | 3300042636 | Bacteria | 2867 |
| 64 | Ga0466724_35649 | 3300042649 | Bacteria | 1381 |
| 65 | Ga0466727_180334 | 3300042655 | Unclassified | 2418 |
| 66 | 2227414132 | 2225789004 | Bacteria | 26384 |
| 67 | IMNBL1DRAFT_c0000548 | 3300000062 | Bacteria | 30522 |
| 68 | IMNBL1DRAFT_c0002134 | 3300000062 | Bacteria | 14054 |
| 69 | JGI24699J35502_11134132 | 3300002509 | Bacteria | 35055 |
| 70 | Ga0072941_1154754 | 3300005201 | Bacteria | 2602 |
| 71 | Ga0123357_10000677 | 3300009784 | Bacteria | 34044 |
| 72 | Ga0415639_172785 | 3300038395 | Bacteria | 1035 |
| 73 | Ga0466707_418877 | 3300042601 | Bacteria | 8249 |
| 74 | Ga0466719_025142 | 3300042606 | Bacteria | 7130 |
| 75 | Ga0466722_031760 | 3300042609 | Bacteria | 2467 |
| 76 | Ga0123357_10087841 | 3300009784 | Bacteria | 4066 |
| 77 | Ga0466723_147188 | 3300042618 | Bacteria | 2342 |
| 78 | Ga0466703_066143 | 3300042636 | Bacteria | 23963 |
| 79 | Ga0466724_38956 | 3300042649 | Bacteria | 4894 |
| 80 | Ga0068305_10205189 | 3300005083 | Bacteria | 5331 |
| 81 | Ga0123357_10000375 | 3300009784 | Bacteria | 42298 |
| 82 | Ga0466657_218051 | 3300042582 | Unclassified | 2090 |
| 83 | Ga0466691_155369 | 3300042593 | Bacteria | 1713 |
| 84 | Ga0466695_311053 | 3300042595 | Bacteria | 3625 |
| 85 | Ga0466696_503091 | 3300042596 | Bacteria | 10551 |
| 86 | Ga0466701_009359 | 3300042598 | Bacteria | 1152 |
| 87 | Ga0466707_049770 | 3300042601 | Bacteria | 2757 |
| 88 | Ga0466713_017181 | 3300042602 | Bacteria | 54753 |
| 89 | Ga0466713_134391 | 3300042602 | Bacteria | 8283 |
| 90 | Ga0466716_038510 | 3300042605 | Bacteria | 24976 |
| 91 | Ga0466722_199911 | 3300042609 | Bacteria | 40153 |
| 92 | Ga0466722_203823 | 3300042609 | Bacteria | 26562 |
| 93 | Ga0123357_10013162 | 3300009784 | Bacteria | 10714 |
| 94 | Ga0123357_10045827 | 3300009784 | Bacteria | 5930 |
| 95 | Ga0123356_10191491 | 3300010049 | Bacteria | 2077 |
| 96 | Ga0123354_10065656 | 3300010882 | Bacteria | 5309 |
| 97 | Ga0466715_080854 | 3300042616 | Bacteria | 9552 |
| 98 | Ga0466715_101945 | 3300042616 | Bacteria | 16309 |
| 99 | Ga0466728_341739 | 3300042620 | Bacteria | 2399 |
| 100 | Ga0466729_112451 | 3300042621 | Bacteria | 6720 |
| 101 | Ga0466729_224585 | 3300042621 | Bacteria | 10662 |
| 102 | Ga0466735_118413 | 3300042624 | Bacteria | 3915 |
| 103 | Ga0466703_213712 | 3300042636 | Bacteria | 10909 |
| 104 | Ga0466704_119350 | 3300042643 | Bacteria | 2203 |
| 105 | Ga0466725_023513 | 3300042654 | Bacteria | 2707 |
| 106 | Ga0466725_249119 | 3300042654 | Bacteria | 1644 |
| 107 | 2227605212 | 2225789004 | Bacteria | 2303 |
| 108 | IMNBL1DRAFT_c0051696 | 3300000062 | Bacteria | 1292 |
| 109 | Ga0466705_006217 | 3300042612 | Bacteria | 5367 |
| 110 | Ga0466705_027776 | 3300042612 | Bacteria | 9671 |
| 111 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 112 | Ga0466690_206073 | 3300042590 | Bacteria | 23524 |
| 113 | Ga0466692_012266 | 3300042591 | Unclassified | 2644 |
| 114 | Ga0466707_047816 | 3300042601 | Bacteria | 12184 |
| 115 | Ga0466707_074626 | 3300042601 | Bacteria | 11995 |
| 116 | Ga0466707_109571 | 3300042601 | Bacteria | 2523 |
| 117 | Ga0123357_10091241 | 3300009784 | Bacteria | 3969 |
| 118 | Ga0123356_10002348 | 3300010049 | Bacteria | 20318 |
| 119 | Ga0123354_10016515 | 3300010882 | Unclassified | 11572 |
| 120 | Ga0123354_10099781 | 3300010882 | Unclassified | 3936 |
| 121 | Ga0466715_279259 | 3300042616 | Bacteria | 15035 |
| 122 | Ga0466728_311604 | 3300042620 | Bacteria | 10551 |
| 123 | Ga0466729_166078 | 3300042621 | Bacteria | 3877 |
| 124 | Ga0466729_230839 | 3300042621 | Bacteria | 12304 |
| 125 | Ga0466735_099615 | 3300042624 | Bacteria | 2925 |
| 126 | Ga0466735_184597 | 3300042624 | Bacteria | 3648 |
| 127 | Ga0466727_245135 | 3300042655 | Bacteria | 3239 |
| 128 | Ga0466727_348275 | 3300042655 | Bacteria | 1340 |
| 129 | IMNBL1DRAFT_c0004858 | 3300000062 | Bacteria | 7907 |
| 130 | JGI24699J35502_11133751 | 3300002509 | Bacteria | 14779 |
| 131 | Ga0466656_090463 | 3300042550 | Bacteria | 2220 |
| 132 | Ga0466692_003792 | 3300042591 | Bacteria | 13439 |
| 133 | Ga0466692_016441 | 3300042591 | Bacteria | 1093 |
| 134 | Ga0466691_106009 | 3300042593 | Bacteria | 1931 |
| 135 | Ga0466700_293568 | 3300042600 | Bacteria | 5024 |
| 136 | Ga0466713_124975 | 3300042602 | Bacteria | 10443 |
| 137 | Ga0466713_140678 | 3300042602 | Bacteria | 25597 |
| 138 | Ga0466713_147122 | 3300042602 | Bacteria | 45505 |
| 139 | Ga0466722_170906 | 3300042609 | Bacteria | 6305 |
| 140 | Ga0123353_10784183 | 3300010167 | Unclassified | 1319 |
| 141 | Ga0123354_10001124 | 3300010882 | Bacteria | 31160 |
| 142 | Ga0123354_10032063 | 3300010882 | Bacteria | 8240 |
| 143 | Ga0466711_321414 | 3300042615 | Bacteria | 11390 |
| 144 | Ga0466725_130397 | 3300042654 | Bacteria | 14031 |
| 145 | IMNBL1DRAFT_c0035898 | 3300000062 | Bacteria | 1740 |
| 146 | IMNBL1DRAFT_c0045654 | 3300000062 | Bacteria | 1428 |
| 147 | Ga0068305_10180290 | 3300005083 | Unclassified | 2944 |
| 148 | Ga0466697_130443 | 3300042611 | Bacteria | 1553 |
| 149 | Ga0466697_274917 | 3300042611 | Bacteria | 203310 |
| 150 | Ga0466705_170456 | 3300042612 | Bacteria | 31533 |
| 151 | Ga0466733_088004 | 3300042659 | Bacteria | 203974 |
| 152 | Ga0466690_314971 | 3300042590 | Bacteria | 5469 |
| 153 | Ga0466696_139714 | 3300042596 | Bacteria | 7938 |
| 154 | Ga0466696_155407 | 3300042596 | Bacteria | 18897 |
| 155 | Ga0466696_424899 | 3300042596 | Bacteria | 3038 |
| 156 | Ga0466719_558082 | 3300042606 | Bacteria | 5471 |
| 157 | Ga0123357_10195927 | 3300009784 | Unclassified | 2314 |
| 158 | Ga0123354_10064008 | 3300010882 | Bacteria | 5398 |
| 159 | Ga0466711_031273 | 3300042615 | Bacteria | 15909 |
| 160 | Ga0466711_320200 | 3300042615 | Bacteria | 3971 |
| 161 | Ga0466715_017060 | 3300042616 | Bacteria | 15472 |
| 162 | Ga0466723_360804 | 3300042618 | Bacteria | 8062 |
| 163 | Ga0466726_238359 | 3300042619 | Bacteria | 5831 |
| 164 | Ga0466735_088535 | 3300042624 | Bacteria | 11616 |
| 165 | Ga0466703_262774 | 3300042636 | Bacteria | 2577 |
| 166 | Ga0466703_342328 | 3300042636 | Archaea | 1513 |
| 167 | Ga0466704_433787 | 3300042643 | Bacteria | 28916 |
| 168 | Ga0466704_488602 | 3300042643 | Bacteria | 43344 |
| 169 | Ga0466727_008762 | 3300042655 | Bacteria | 5046 |
| 170 | Ga0466727_081347 | 3300042655 | Bacteria | 65648 |
| 171 | IMNBL1DRAFT_c0002295 | 3300000062 | Bacteria | 13432 |
| 172 | JGI24702J35022_10028586 | 3300002462 | Bacteria | 2994 |
| 173 | JGI24702J35022_10218607 | 3300002462 | Unclassified | 1097 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.