Protein Family IF09100
Metagenome
Isolate
148
Members
43
Samples
147
Scaffolds
283.43
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_033077|Ga0466703_033077_3694_4695
- Length
- 303 aa
- Sequence
- VSAAAGGAGKRNFGPLYSVPMAVWFTVFFIVPLLIIILYSFLKKELYGGVAPEFSLTAYRSLGNPSLIIIIIRTTIFIALPCGYFMAKSKHQTFLLLIIIIPFWTNFLIRVFAWMNILGNNGFLNELLIRLGLLVKDIYLQKVVILILVYMYLPYAILPLYATIDKFDFSLLEAARDLGATKPQSMLKVLLPNIRSGMYTAVLFTFIPIFGAYAVPLLVGGKDSYMLGNVIADQLTKSRNWPLASAISLVLTLVTTAGVLLIMGLQKRDAVRFQGVRGREAGLSAEAGVPTEGPPAAAGGDAP
Sample Types
Isolate
0.7%
Metagenome
99.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.5%
Kalotermitidae
32.6%
Rhinotermitidae
9.3%
Unclassified
7.0%
Termopsidae
7.0%
Blaberidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_001544 | 3300042614 | Bacteria | 23939 |
| 2 | Ga0466715_012720 | 3300042616 | Bacteria | 11389 |
| 3 | Ga0466715_530626 | 3300042616 | Bacteria | 2061 |
| 4 | Ga0466718_100564 | 3300042617 | Bacteria | 4057 |
| 5 | Ga0466726_156561 | 3300042619 | Bacteria | 1839 |
| 6 | Ga0123356_10712873 | 3300010049 | Bacteria | 1173 |
| 7 | Ga0466716_366491 | 3300042605 | Bacteria | 2296 |
| 8 | Ga0466719_036412 | 3300042606 | Bacteria | 2607 |
| 9 | Ga0466720_000159 | 3300042607 | Bacteria | 3656 |
| 10 | Ga0466720_031498 | 3300042607 | Bacteria | 3259 |
| 11 | Ga0466720_061132 | 3300042607 | Bacteria | 4410 |
| 12 | Ga0466691_117863 | 3300042593 | Bacteria | 11001 |
| 13 | AustNasuHG_c1001315 | 3300000089 | Bacteria | 8913 |
| 14 | JGI24698J34947_10035908 | 3300002449 | Bacteria | 2583 |
| 15 | Ga0466735_146974 | 3300042624 | Bacteria | 11565 |
| 16 | Ga0466703_259866 | 3300042636 | Bacteria | 18284 |
| 17 | Ga0466712_039575 | 3300042614 | Bacteria | 16606 |
| 18 | Ga0466712_134996 | 3300042614 | Bacteria | 9831 |
| 19 | Ga0466711_196196 | 3300042615 | Bacteria | 12597 |
| 20 | Ga0466718_039024 | 3300042617 | Bacteria | 2173 |
| 21 | Ga0466723_266624 | 3300042618 | Bacteria | 6530 |
| 22 | Ga0466729_162098 | 3300042621 | Bacteria | 1599 |
| 23 | Ga0123357_10322828 | 3300009784 | Bacteria | 1522 |
| 24 | Ga0123353_10276947 | 3300010167 | Bacteria | 2580 |
| 25 | Ga0466716_391534 | 3300042605 | Unclassified | 5433 |
| 26 | Ga0466720_093334 | 3300042607 | Bacteria | 20053 |
| 27 | Ga0466690_004411 | 3300042590 | Bacteria | 3233 |
| 28 | Ga0466692_122700 | 3300042591 | Bacteria | 4634 |
| 29 | Ga0466691_136918 | 3300042593 | Bacteria | 5850 |
| 30 | Ga0466696_160723 | 3300042596 | Bacteria | 2029 |
| 31 | JGI24698J34947_10025429 | 3300002449 | Bacteria | 3151 |
| 32 | JGI24695J34938_10004976 | 3300002450 | Bacteria | 8480 |
| 33 | Ga0466712_049935 | 3300042614 | Bacteria | 22184 |
| 34 | Ga0466712_293740 | 3300042614 | Bacteria | 9154 |
| 35 | Ga0466718_029713 | 3300042617 | Bacteria | 7485 |
| 36 | Ga0466718_119621 | 3300042617 | Bacteria | 6644 |
| 37 | Ga0466726_178903 | 3300042619 | Bacteria | 4671 |
| 38 | Ga0466726_264727 | 3300042619 | Bacteria | 1574 |
| 39 | Ga0466728_204649 | 3300042620 | Bacteria | 6076 |
| 40 | Ga0466729_143311 | 3300042621 | Bacteria | 1926 |
| 41 | Ga0466706_184489 | 3300042599 | Bacteria | 2243 |
| 42 | Ga0466707_015438 | 3300042601 | Bacteria | 8129 |
| 43 | Ga0466713_121338 | 3300042602 | Bacteria | 3624 |
| 44 | Ga0466722_071213 | 3300042609 | Bacteria | 5778 |
| 45 | Ga0456237_0017137 | 3300041968 | Bacteria | 1018 |
| 46 | Ga0466694_058135 | 3300042594 | Bacteria | 8662 |
| 47 | Ga0466696_321893 | 3300042596 | Bacteria | 2848 |
| 48 | JGI24698J34947_10021997 | 3300002449 | Bacteria | 3424 |
| 49 | JGI24697J35500_11266914 | 3300002507 | Bacteria | 3579 |
| 50 | Ga0466704_143077 | 3300042643 | Bacteria | 3839 |
| 51 | Ga0466709_223647 | 3300042648 | Unclassified | 2176 |
| 52 | Ga0466709_279548 | 3300042648 | Bacteria | 7052 |
| 53 | Ga0466708_072666 | 3300042652 | Bacteria | 3019 |
| 54 | Ga0466712_231195 | 3300042614 | Bacteria | 9467 |
| 55 | Ga0466711_455697 | 3300042615 | Bacteria | 1897 |
| 56 | Ga0466715_106859 | 3300042616 | Unclassified | 2103 |
| 57 | Ga0466718_025688 | 3300042617 | Bacteria | 8125 |
| 58 | Ga0466726_113339 | 3300042619 | Bacteria | 3400 |
| 59 | Ga0466726_330522 | 3300042619 | Bacteria | 1048 |
| 60 | Ga0466728_450843 | 3300042620 | Bacteria | 2773 |
| 61 | Ga0123356_10001100 | 3300010049 | Bacteria | 29997 |
| 62 | Ga0466722_009738 | 3300042609 | Bacteria | 1911 |
| 63 | Ga0466722_019174 | 3300042609 | Bacteria | 4253 |
| 64 | Ga0466690_047737 | 3300042590 | Bacteria | 13983 |
| 65 | Ga0466691_086166 | 3300042593 | Bacteria | 11074 |
| 66 | Ga0466735_067058 | 3300042624 | Bacteria | 1276 |
| 67 | Ga0466703_053792 | 3300042636 | Bacteria | 16450 |
| 68 | Ga0466704_193218 | 3300042643 | Bacteria | 13736 |
| 69 | Ga0466704_267900 | 3300042643 | Bacteria | 17460 |
| 70 | Ga0466711_167327 | 3300042615 | Bacteria | 4991 |
| 71 | Ga0123353_10338387 | 3300010167 | Bacteria | 2274 |
| 72 | Ga0466706_147172 | 3300042599 | Bacteria | 1576 |
| 73 | Ga0415639_105757 | 3300038395 | Bacteria | 5178 |
| 74 | Ga0415639_208665 | 3300038395 | Bacteria | 1703 |
| 75 | Ga0466690_206407 | 3300042590 | Bacteria | 1003 |
| 76 | Ga0466696_204726 | 3300042596 | Bacteria | 35245 |
| 77 | Ga0466699_024350 | 3300042597 | Bacteria | 3435 |
| 78 | Ga0072940_1107923 | 3300005200 | Bacteria | 2397 |
| 79 | Ga0466702_376116 | 3300042635 | Bacteria | 12364 |
| 80 | Ga0466703_033077 | 3300042636 | Bacteria | 6958 |
| 81 | Ga0466703_046826 | 3300042636 | Bacteria | 17052 |
| 82 | Ga0466703_248567 | 3300042636 | Bacteria | 8923 |
| 83 | Ga0466703_282424 | 3300042636 | Bacteria | 1603 |
| 84 | Ga0466704_214375 | 3300042643 | Bacteria | 11779 |
| 85 | Ga0466708_045381 | 3300042652 | Bacteria | 24821 |
| 86 | Ga0466708_205489 | 3300042652 | Bacteria | 10696 |
| 87 | Ga0466727_177471 | 3300042655 | Bacteria | 1748 |
| 88 | Ga0466705_210210 | 3300042612 | Bacteria | 14341 |
| 89 | Ga0466705_216646 | 3300042612 | Bacteria | 5124 |
| 90 | Ga0466705_514040 | 3300042612 | Bacteria | 10928 |
| 91 | Ga0466712_003620 | 3300042614 | Bacteria | 7469 |
| 92 | Ga0466711_410348 | 3300042615 | Bacteria | 14838 |
| 93 | Ga0466715_416724 | 3300042616 | Bacteria | 6552 |
| 94 | Ga0466718_057307 | 3300042617 | Bacteria | 2872 |
| 95 | Ga0466723_026644 | 3300042618 | Bacteria | 4981 |
| 96 | Ga0466728_054193 | 3300042620 | Bacteria | 11218 |
| 97 | Ga0466719_063526 | 3300042606 | Bacteria | 8651 |
| 98 | Ga0466719_124282 | 3300042606 | Bacteria | 55942 |
| 99 | Ga0466720_057115 | 3300042607 | Bacteria | 2547 |
| 100 | Ga0466690_097572 | 3300042590 | Bacteria | 5423 |
| 101 | Ga0466691_162775 | 3300042593 | Bacteria | 4338 |
| 102 | Ga0466696_083391 | 3300042596 | Bacteria | 3652 |
| 103 | JGI24698J34947_10001518 | 3300002449 | Bacteria | 12273 |
| 104 | Ga0466709_025162 | 3300042648 | Bacteria | 5757 |
| 105 | Ga0466708_044868 | 3300042652 | Bacteria | 5271 |
| 106 | Ga0466705_052827 | 3300042612 | Bacteria | 1993 |
| 107 | Ga0466705_090032 | 3300042612 | Bacteria | 6876 |
| 108 | Ga0466712_053304 | 3300042614 | Bacteria | 13915 |
| 109 | Ga0466712_279165 | 3300042614 | Unclassified | 2795 |
| 110 | Ga0466715_045566 | 3300042616 | Bacteria | 2932 |
| 111 | Ga0466715_250144 | 3300042616 | Bacteria | 8670 |
| 112 | Ga0466723_046140 | 3300042618 | Bacteria | 5976 |
| 113 | Ga0466729_125549 | 3300042621 | Bacteria | 1696 |
| 114 | Ga0123355_10332043 | 3300009826 | Bacteria | 2036 |
| 115 | Ga0466690_070367 | 3300042590 | Bacteria | 3493 |
| 116 | Ga0466692_190792 | 3300042591 | Bacteria | 17695 |
| 117 | Ga0466691_104861 | 3300042593 | Bacteria | 10770 |
| 118 | JGI24698J34947_10001186 | 3300002449 | Bacteria | 13605 |
| 119 | JGI24698J34947_10008794 | 3300002449 | Bacteria | 5538 |
| 120 | JGI24698J34947_10025390 | 3300002449 | Bacteria | 3154 |
| 121 | JGI24698J34947_10034826 | 3300002449 | Bacteria | 2632 |
| 122 | Ga0068305_10033882 | 3300005083 | Bacteria | 2719 |
| 123 | Ga0466703_144259 | 3300042636 | Bacteria | 4333 |
| 124 | Ga0466703_209417 | 3300042636 | Bacteria | 3738 |
| 125 | Ga0466704_361047 | 3300042643 | Bacteria | 54186 |
| 126 | Ga0466732_194744 | 3300042656 | Bacteria | 3870 |
| 127 | Ga0466712_116775 | 3300042614 | Bacteria | 1379 |
| 128 | Ga0466711_077159 | 3300042615 | Bacteria | 12050 |
| 129 | Ga0466715_356099 | 3300042616 | Bacteria | 5314 |
| 130 | Ga0466723_171803 | 3300042618 | Bacteria | 59143 |
| 131 | Ga0466729_028346 | 3300042621 | Bacteria | 2348 |
| 132 | Ga0466716_121392 | 3300042605 | Bacteria | 28760 |
| 133 | Ga0466716_243278 | 3300042605 | Bacteria | 3305 |
| 134 | Ga0466720_024816 | 3300042607 | Bacteria | 3005 |
| 135 | Ga0466720_072771 | 3300042607 | Bacteria | 5958 |
| 136 | Ga0466690_012365 | 3300042590 | Bacteria | 4825 |
| 137 | Ga0466690_231509 | 3300042590 | Bacteria | 1034 |
| 138 | Ga0466690_243966 | 3300042590 | Bacteria | 7676 |
| 139 | Ga0466692_022165 | 3300042591 | Bacteria | 15406 |
| 140 | Ga0466696_162358 | 3300042596 | Bacteria | 7687 |
| 141 | JGI24698J34947_10006792 | 3300002449 | Bacteria | 6287 |
| 142 | JGI24698J34947_10051047 | 3300002449 | Bacteria | 2082 |
| 143 | JGI24695J34938_10007312 | 3300002450 | Bacteria | 6494 |
| 144 | Ga0466735_106933 | 3300042624 | Bacteria | 10772 |
| 145 | Ga0466708_068609 | 3300042652 | Bacteria | 43792 |
| 146 | Ga0466708_115320 | 3300042652 | Unclassified | 6335 |
| 147 | Ga0466727_275352 | 3300042655 | Bacteria | 1210 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 80 | 267 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.