Protein Family IF09031
Metagenome
Metatranscriptome
Isolate
213
Members
58
Samples
203
Scaffolds
362.35
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_015189|Ga0466702_015189_1238_2299
- Length
- 353 aa
- Sequence
- MSEKVLMKGNDAIAEAAIRAGCGAYFGYPITPQNELIAYMAKNMLDKGRIFIQAESEIAAIIMVYGASCAGLRAMTSSSSPGISLKQEGMSYAAGADVPLVLVNVVRGGPGLGNIAPAQSDYMQSTRGGGHGDYRSIVLAPKSVQECADQTYLAFDLADKYRMPVIILADGMIGQMIEGVTLPPEKEPPKREWSVGNMASKKKAVHITSIDLVPERLEAQTKARFERYEKVKEAEIRFEENSCADADLVMVAYGTSSRVCLGAQMLAKKEGIKLGLFRPITLWPFPYEALGKIAAQGKPVLTVEMSEGQLVEDVKLSAFQAGAKNNIHLLAHSGGIIPTEEEVFAKAKEILKK
Sample Types
Isolate
4.7%
Metagenome
94.8%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
25.0%
Unclassified
19.6%
Rhinotermitidae
7.1%
Termopsidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
206
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 2 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 30 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 33 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 34 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 46 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 47 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 53 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_194410 | 3300042599 | Bacteria | 6028 |
| 2 | Ga0466713_014972 | 3300042602 | Bacteria | 1362 |
| 3 | Ga0466722_075469 | 3300042609 | Bacteria | 5149 |
| 4 | Ga0466722_080196 | 3300042609 | Bacteria | 4429 |
| 5 | Ga0466722_167162 | 3300042609 | Bacteria | 10567 |
| 6 | Ga0466722_263493 | 3300042609 | Bacteria | 4318 |
| 7 | Ga0123357_10185937 | 3300009784 | Bacteria | 2411 |
| 8 | Ga0123356_10424105 | 3300010049 | Bacteria | 1473 |
| 9 | AustNasuHG_c1000135 | 3300000089 | Bacteria | 22970 |
| 10 | AustNasuHG_c1014546 | 3300000089 | Bacteria | 2672 |
| 11 | JGI24695J34938_10009476 | 3300002450 | Bacteria | 5413 |
| 12 | JGI24695J34938_10073124 | 3300002450 | Bacteria | 1428 |
| 13 | Ga0466705_253181 | 3300042612 | Bacteria | 6539 |
| 14 | Ga0466703_161480 | 3300042636 | Bacteria | 28463 |
| 15 | Ga0466708_059682 | 3300042652 | Bacteria | 15983 |
| 16 | Ga0466711_030716 | 3300042615 | Bacteria | 19173 |
| 17 | Ga0466711_136100 | 3300042615 | Bacteria | 7327 |
| 18 | Ga0466718_153082 | 3300042617 | Bacteria | 1344 |
| 19 | Ga0466723_011294 | 3300042618 | Bacteria | 53611 |
| 20 | Ga0223687_100376 | 3300021217 | Bacteria | 1138 |
| 21 | Ga0264413_100675 | 3300024493 | Bacteria | 52863 |
| 22 | Ga0466690_155651 | 3300042590 | Bacteria | 10688 |
| 23 | Ga0466692_138827 | 3300042591 | Bacteria | 1603 |
| 24 | Ga0466693_023818 | 3300042592 | Bacteria | 15300 |
| 25 | Ga0466691_121254 | 3300042593 | Bacteria | 16039 |
| 26 | Ga0466732_054799 | 3300042656 | Bacteria | 38151 |
| 27 | Ga0466733_083144 | 3300042659 | Bacteria | 1729 |
| 28 | Ga0466717_054594 | 3300042604 | Bacteria | 2378 |
| 29 | Ga0466716_240321 | 3300042605 | Bacteria | 1820 |
| 30 | Ga0466719_014192 | 3300042606 | Bacteria | 9128 |
| 31 | Ga0466719_015498 | 3300042606 | Bacteria | 9322 |
| 32 | Ga0466722_108234 | 3300042609 | Bacteria | 4076 |
| 33 | Ga0123353_10010965 | 3300010167 | Bacteria | 12713 |
| 34 | Ga0123353_10303995 | 3300010167 | Bacteria | 2433 |
| 35 | JGI24698J34947_10003808 | 3300002449 | Bacteria | 8219 |
| 36 | JGI24696J40584_12951473 | 3300002834 | Bacteria | 2248 |
| 37 | Ga0466705_241169 | 3300042612 | Bacteria | 18952 |
| 38 | Ga0466702_160761 | 3300042635 | Bacteria | 6932 |
| 39 | Ga0466703_200148 | 3300042636 | Bacteria | 16464 |
| 40 | Ga0466703_370479 | 3300042636 | Bacteria | 72306 |
| 41 | Ga0466704_263754 | 3300042643 | Bacteria | 34688 |
| 42 | Ga0466709_019038 | 3300042648 | Bacteria | 10439 |
| 43 | Ga0466708_283378 | 3300042652 | Bacteria | 3764 |
| 44 | Ga0466727_061387 | 3300042655 | Bacteria | 3300 |
| 45 | Ga0466712_061426 | 3300042614 | Unclassified | 1765 |
| 46 | Ga0466712_062408 | 3300042614 | Bacteria | 9799 |
| 47 | Ga0466711_109103 | 3300042615 | Bacteria | 16915 |
| 48 | Ga0466723_065698 | 3300042618 | Bacteria | 2730 |
| 49 | Ga0466723_071185 | 3300042618 | Bacteria | 53854 |
| 50 | Ga0466723_109373 | 3300042618 | Bacteria | 9822 |
| 51 | Ga0466726_174911 | 3300042619 | Bacteria | 5892 |
| 52 | Ga0466726_233407 | 3300042619 | Bacteria | 6256 |
| 53 | Ga0466726_489090 | 3300042619 | Bacteria | 5911 |
| 54 | Ga0466728_337586 | 3300042620 | Bacteria | 3420 |
| 55 | Ga0456237_0002871 | 3300041968 | Bacteria | 2796 |
| 56 | Ga0466690_131904 | 3300042590 | Unclassified | 7775 |
| 57 | Ga0466692_127392 | 3300042591 | Bacteria | 10743 |
| 58 | Ga0466692_135679 | 3300042591 | Bacteria | 12494 |
| 59 | Ga0466693_187683 | 3300042592 | Bacteria | 64758 |
| 60 | Ga0466691_015410 | 3300042593 | Bacteria | 9318 |
| 61 | Ga0466699_178630 | 3300042597 | Bacteria | 1431 |
| 62 | Ga0466699_419178 | 3300042597 | Bacteria | 17419 |
| 63 | Ga0123353_10026461 | 3300010167 | Bacteria | 8860 |
| 64 | AustNasuHG_c1007376 | 3300000089 | Bacteria | 3914 |
| 65 | JGI24698J34947_10003831 | 3300002449 | Bacteria | 8189 |
| 66 | JGI24695J34938_10001829 | 3300002450 | Bacteria | 17383 |
| 67 | JGI24695J34938_10008580 | 3300002450 | Bacteria | 5810 |
| 68 | Ga0072940_1127670 | 3300005200 | Bacteria | 1990 |
| 69 | Ga0466703_108586 | 3300042636 | Bacteria | 3096 |
| 70 | Ga0466704_431663 | 3300042643 | Bacteria | 11076 |
| 71 | Ga0466708_161973 | 3300042652 | Bacteria | 41034 |
| 72 | Ga0466708_231994 | 3300042652 | Bacteria | 19095 |
| 73 | Ga0466708_290798 | 3300042652 | Bacteria | 2958 |
| 74 | Ga0466711_196498 | 3300042615 | Bacteria | 2035 |
| 75 | Ga0466715_088707 | 3300042616 | Bacteria | 3025 |
| 76 | Ga0466715_096965 | 3300042616 | Bacteria | 2973 |
| 77 | Ga0466723_035078 | 3300042618 | Bacteria | 74340 |
| 78 | Ga0466723_165588 | 3300042618 | Bacteria | 2459 |
| 79 | Ga0466726_050757 | 3300042619 | Bacteria | 1708 |
| 80 | Ga0466726_261634 | 3300042619 | Bacteria | 1245 |
| 81 | Ga0466726_335378 | 3300042619 | Bacteria | 2747 |
| 82 | Ga0415639_095575 | 3300038395 | Unclassified | 1707 |
| 83 | Ga0466690_029986 | 3300042590 | Bacteria | 7139 |
| 84 | Ga0466692_148882 | 3300042591 | Bacteria | 1407 |
| 85 | Ga0466693_207622 | 3300042592 | Bacteria | 1268 |
| 86 | Ga0466696_096338 | 3300042596 | Bacteria | 6303 |
| 87 | Ga0466699_398496 | 3300042597 | Bacteria | 26587 |
| 88 | Ga0466732_055294 | 3300042656 | Bacteria | 5843 |
| 89 | Ga0466733_017112 | 3300042659 | Bacteria | 2376 |
| 90 | Ga0466733_191093 | 3300042659 | Bacteria | 1807 |
| 91 | Ga0466719_525115 | 3300042606 | Bacteria | 18067 |
| 92 | Ga0466722_003775 | 3300042609 | Bacteria | 3801 |
| 93 | Ga0466698_059742 | 3300042610 | Bacteria | 1739 |
| 94 | Ga0123356_10228106 | 3300010049 | Bacteria | 1924 |
| 95 | Ga0123353_10045837 | 3300010167 | Bacteria | 6943 |
| 96 | Ga0123353_10456414 | 3300010167 | Bacteria | 1879 |
| 97 | AustNasuHG_c1018887 | 3300000089 | Bacteria | 2268 |
| 98 | JGI24698J34947_10001100 | 3300002449 | Bacteria | 13934 |
| 99 | JGI24698J34947_10068616 | 3300002449 | Bacteria | 1714 |
| 100 | JGI24695J34938_10000266 | 3300002450 | Bacteria | 50844 |
| 101 | Ga0466709_363533 | 3300042648 | Bacteria | 1760 |
| 102 | Ga0466708_040343 | 3300042652 | Bacteria | 5964 |
| 103 | Ga0466715_046154 | 3300042616 | Bacteria | 2298 |
| 104 | Ga0466726_165702 | 3300042619 | Bacteria | 7153 |
| 105 | Ga0264413_100674 | 3300024493 | Bacteria | 17366 |
| 106 | Ga0264413_101139 | 3300024493 | Bacteria | 4468 |
| 107 | Ga0466692_082197 | 3300042591 | Bacteria | 8006 |
| 108 | Ga0466692_142514 | 3300042591 | Bacteria | 23774 |
| 109 | Ga0466692_187653 | 3300042591 | Bacteria | 1978 |
| 110 | Ga0466693_002405 | 3300042592 | Bacteria | 54310 |
| 111 | Ga0466691_104347 | 3300042593 | Bacteria | 19831 |
| 112 | Ga0466699_272603 | 3300042597 | Bacteria | 1290 |
| 113 | Ga0466720_048449 | 3300042607 | Unclassified | 1760 |
| 114 | Ga0123356_10000059 | 3300010049 | Bacteria | 117133 |
| 115 | Ga0123353_10082593 | 3300010167 | Bacteria | 5168 |
| 116 | Ga0123353_10528414 | 3300010167 | Bacteria | 1709 |
| 117 | JGI24695J34938_10000048 | 3300002450 | Bacteria | 91577 |
| 118 | JGI24695J34938_10001343 | 3300002450 | Bacteria | 21253 |
| 119 | Ga0466704_035234 | 3300042643 | Bacteria | 3438 |
| 120 | Ga0466704_119486 | 3300042643 | Bacteria | 3229 |
| 121 | Ga0466709_041394 | 3300042648 | Bacteria | 16988 |
| 122 | Ga0466709_227983 | 3300042648 | Bacteria | 10490 |
| 123 | Ga0466708_209929 | 3300042652 | Bacteria | 22287 |
| 124 | Ga0466727_222092 | 3300042655 | Bacteria | 3428 |
| 125 | Ga0466711_153118 | 3300042615 | Bacteria | 2069 |
| 126 | Ga0466715_508524 | 3300042616 | Unclassified | 2532 |
| 127 | Ga0466718_063151 | 3300042617 | Bacteria | 1151 |
| 128 | Ga0466723_296272 | 3300042618 | Bacteria | 6055 |
| 129 | Ga0466726_122771 | 3300042619 | Bacteria | 5589 |
| 130 | Ga0466726_339688 | 3300042619 | Bacteria | 4574 |
| 131 | Ga0466726_466054 | 3300042619 | Bacteria | 4237 |
| 132 | Ga0264413_101463 | 3300024493 | Bacteria | 9391 |
| 133 | Ga0466692_030327 | 3300042591 | Bacteria | 3140 |
| 134 | Ga0466692_046498 | 3300042591 | Bacteria | 16917 |
| 135 | Ga0466691_013286 | 3300042593 | Bacteria | 5352 |
| 136 | Ga0466695_220293 | 3300042595 | Bacteria | 1581 |
| 137 | Ga0466699_272911 | 3300042597 | Bacteria | 4868 |
| 138 | Ga0466699_294460 | 3300042597 | Bacteria | 2588 |
| 139 | Ga0466722_167562 | 3300042609 | Bacteria | 2796 |
| 140 | Ga0072941_1013730 | 3300005201 | Bacteria | 14915 |
| 141 | Ga0466729_249938 | 3300042621 | Bacteria | 1714 |
| 142 | Ga0466702_015189 | 3300042635 | Bacteria | 6131 |
| 143 | Ga0466703_025784 | 3300042636 | Bacteria | 9815 |
| 144 | Ga0466703_314709 | 3300042636 | Bacteria | 6827 |
| 145 | Ga0466704_198864 | 3300042643 | Bacteria | 4218 |
| 146 | Ga0466709_353295 | 3300042648 | Bacteria | 7078 |
| 147 | Ga0466708_037942 | 3300042652 | Bacteria | 2983 |
| 148 | Ga0466712_062399 | 3300042614 | Bacteria | 1508 |
| 149 | Ga0466711_394207 | 3300042615 | Bacteria | 10941 |
| 150 | Ga0466723_088339 | 3300042618 | Bacteria | 2428 |
| 151 | Ga0466723_237253 | 3300042618 | Bacteria | 3874 |
| 152 | Ga0466726_224555 | 3300042619 | Bacteria | 8011 |
| 153 | Ga0466728_101158 | 3300042620 | Bacteria | 7513 |
| 154 | Ga0466728_356316 | 3300042620 | Bacteria | 6303 |
| 155 | Ga0264413_100676 | 3300024493 | Bacteria | 7753 |
| 156 | Ga0456237_0007860 | 3300041968 | Unclassified | 1631 |
| 157 | Ga0466694_024974 | 3300042594 | Bacteria | 29638 |
| 158 | Ga0466694_029819 | 3300042594 | Bacteria | 1446 |
| 159 | Ga0466694_119073 | 3300042594 | Bacteria | 2437 |
| 160 | Ga0466696_304377 | 3300042596 | Bacteria | 4821 |
| 161 | Ga0466696_396422 | 3300042596 | Bacteria | 1526 |
| 162 | Ga0466699_403811 | 3300042597 | Bacteria | 9279 |
| 163 | Ga0466716_003336 | 3300042605 | Bacteria | 2149 |
| 164 | Ga0466720_135022 | 3300042607 | Bacteria | 4855 |
| 165 | Ga0466720_172082 | 3300042607 | Unclassified | 2967 |
| 166 | Ga0123353_10074768 | 3300010167 | Bacteria | 5446 |
| 167 | Ga0123353_10611947 | 3300010167 | Bacteria | 1554 |
| 168 | JGI24695J34938_10003783 | 3300002450 | Bacteria | 10307 |
| 169 | JGI24695J34938_10030755 | 3300002450 | Bacteria | 2497 |
| 170 | Ga0466705_086293 | 3300042612 | Bacteria | 3337 |
| 171 | Ga0466705_210971 | 3300042612 | Bacteria | 12078 |
| 172 | Ga0466730_038157 | 3300042625 | Bacteria | 1154 |
| 173 | Ga0466703_023957 | 3300042636 | Bacteria | 4133 |
| 174 | Ga0466704_170021 | 3300042643 | Bacteria | 6719 |
| 175 | Ga0466727_157650 | 3300042655 | Bacteria | 11131 |
| 176 | Ga0466718_164752 | 3300042617 | Bacteria | 4130 |
| 177 | Ga0466726_178485 | 3300042619 | Bacteria | 1512 |
| 178 | Ga0415639_027225 | 3300038395 | Bacteria | 1387 |
| 179 | Ga0466690_050608 | 3300042590 | Bacteria | 16411 |
| 180 | Ga0466692_107474 | 3300042591 | Bacteria | 5402 |
| 181 | Ga0466693_410767 | 3300042592 | Bacteria | 1661 |
| 182 | Ga0466691_006514 | 3300042593 | Bacteria | 12658 |
| 183 | Ga0466691_027014 | 3300042593 | Bacteria | 1285 |
| 184 | Ga0466691_110786 | 3300042593 | Bacteria | 5830 |
| 185 | Ga0466694_268649 | 3300042594 | Bacteria | 30529 |
| 186 | Ga0466696_039989 | 3300042596 | Bacteria | 12013 |
| 187 | Ga0466696_329205 | 3300042596 | Bacteria | 9038 |
| 188 | Ga0466699_044217 | 3300042597 | Bacteria | 6587 |
| 189 | Ga0466719_539018 | 3300042606 | Bacteria | 14735 |
| 190 | Ga0466720_000962 | 3300042607 | Bacteria | 4576 |
| 191 | Ga0123356_10418338 | 3300010049 | Bacteria | 1482 |
| 192 | Ga0123353_10679895 | 3300010167 | Bacteria | 1450 |
| 193 | JGI24695J34938_10000137 | 3300002450 | Bacteria | 66242 |
| 194 | Ga0074263_113663 | 3300005485 | Bacteria | 3269 |
| 195 | Ga0466712_247660 | 3300042614 | Bacteria | 8293 |
| 196 | Ga0466715_165751 | 3300042616 | Bacteria | 3424 |
| 197 | Ga0466718_104039 | 3300042617 | Bacteria | 3403 |
| 198 | Ga0456237_0000425 | 3300041968 | Bacteria | 6382 |
| 199 | Ga0466692_107443 | 3300042591 | Bacteria | 1450 |
| 200 | Ga0466692_112428 | 3300042591 | Bacteria | 3787 |
| 201 | Ga0466693_121162 | 3300042592 | Bacteria | 2241 |
| 202 | Ga0466691_027913 | 3300042593 | Bacteria | 52900 |
| 203 | Ga0466696_192002 | 3300042596 | Bacteria | 11633 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01855 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.