Protein Family IF09030
Metagenome
Isolate
120
Members
63
Samples
104
Scaffolds
321.21
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_005468|Ga0466702_005468_347_1417
- Length
- 356 aa
- Sequence
- MHWGENSGGGKGAWHGSLCFQRSHNQKHDRKNKGVKLMNIKTRRLRGSDILRRMVRETRFSCDSLIYPLFIREGSGIEEALPSLPGQTRYSPDTVAKGIETAMKAGVSSFLFFGLPKNKDEQGSGAYDENGVVQQALKNTRKIFGNDVQLITDVCLCEYTSHGHCGLVSNGKVDNDATLPLLAKTALSHLHSGSDIVAPSAMMDGSVAAIRNVLDAPIMSYAAKYASAFYGPFREAAESTPQFGDRKTYQMDYHNSKEALKRIEIDIQEGADIIIVKPALAYLDIVCKTSELVKVPIAAYSVSGEYAMIKAAAASGGVDEYSAMCESAVAVFRAGANILITYFAKEIAAAIRRGDA
Sample Types
Isolate
13.3%
Metagenome
86.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
49.2%
Unclassified
21.3%
Kalotermitidae
13.1%
Elmidae
4.9%
Rhinotermitidae
3.3%
Termopsidae
3.3%
Hodotermitidae
1.6%
Scarabaeidae
1.6%
Drosophilidae
1.6%
Taxonomy
Archaea
3
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 18 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 19 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 31 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 32 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 33 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 34 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 35 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 36 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 39 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 40 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 52 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 53 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 54 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 55 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 58 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 59 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 60 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 63 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_178442 | 3300042656 | Bacteria | 1271 |
| 2 | Ga0466712_002978 | 3300042614 | Bacteria | 5936 |
| 3 | Ga0466712_133351 | 3300042614 | Bacteria | 20055 |
| 4 | Ga0415639_153792 | 3300038395 | Bacteria | 1062 |
| 5 | Ga0123355_10001301 | 3300009826 | Bacteria | 34846 |
| 6 | Ga0123355_10102361 | 3300009826 | Bacteria | 4505 |
| 7 | Ga0123353_10004832 | 3300010167 | Bacteria | 17504 |
| 8 | JGI24702J35022_10035643 | 3300002462 | Bacteria | 2661 |
| 9 | Ga0072940_1120610 | 3300005200 | Bacteria | 1415 |
| 10 | Ga0072941_1006320 | 3300005201 | Bacteria | 39063 |
| 11 | Ga0072941_1021650 | 3300005201 | Bacteria | 13194 |
| 12 | Ga0466707_153833 | 3300042601 | Bacteria | 5286 |
| 13 | Ga0466720_011769 | 3300042607 | Bacteria | 11595 |
| 14 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 15 | Ga0466726_369203 | 3300042619 | Bacteria | 4083 |
| 16 | Ga0123355_10355629 | 3300009826 | Bacteria | 1935 |
| 17 | Ga0123353_10383496 | 3300010167 | Bacteria | 2101 |
| 18 | Ga0123353_10920798 | 3300010167 | Bacteria | 1187 |
| 19 | AustNasuHG_c1011686 | 3300000089 | Bacteria | 3041 |
| 20 | JGI24698J34947_10014802 | 3300002449 | Bacteria | 4248 |
| 21 | Ga0072940_1171987 | 3300005200 | Bacteria | 3395 |
| 22 | Ga0466701_040622 | 3300042598 | Bacteria | 282607 |
| 23 | Ga0466716_128494 | 3300042605 | Bacteria | 6440 |
| 24 | Ga0466720_100020 | 3300042607 | Bacteria | 31760 |
| 25 | Ga0466702_157557 | 3300042635 | Bacteria | 5660 |
| 26 | Ga0466702_457436 | 3300042635 | Bacteria | 1868 |
| 27 | Ga0466727_277282 | 3300042655 | Bacteria | 1901 |
| 28 | Ga0466715_121267 | 3300042616 | Bacteria | 1814 |
| 29 | Ga0466718_041095 | 3300042617 | Bacteria | 43589 |
| 30 | Ga0466723_027465 | 3300042618 | Bacteria | 52841 |
| 31 | Ga0264413_103743 | 3300024493 | Bacteria | 33640 |
| 32 | Ga0466693_064049 | 3300042592 | Bacteria | 2736 |
| 33 | Ga0123355_10237350 | 3300009826 | Bacteria | 2591 |
| 34 | JGI24700J35501_10929298 | 3300002508 | Bacteria | 8992 |
| 35 | JGI24696J40584_12951176 | 3300002834 | Bacteria | 2217 |
| 36 | Ga0072940_1044703 | 3300005200 | Bacteria | 5414 |
| 37 | Ga0466707_261978 | 3300042601 | Bacteria | 6687 |
| 38 | Ga0466731_219804 | 3300042622 | Bacteria | 1978 |
| 39 | Ga0466710_422353 | 3300042613 | Bacteria | 1639 |
| 40 | Ga0123355_10306670 | 3300009826 | Bacteria | 2157 |
| 41 | AustNasuHG_c1022279 | 3300000089 | Bacteria | 2037 |
| 42 | AustNasuHG_c1030427 | 3300000089 | Unclassified | 1554 |
| 43 | JGI24702J35022_10001170 | 3300002462 | Bacteria | 16317 |
| 44 | Ga0072941_1058199 | 3300005201 | Bacteria | 3335 |
| 45 | Ga0074308_1115356 | 3300005307 | Bacteria | 1401 |
| 46 | Ga0466700_059960 | 3300042600 | Bacteria | 4627 |
| 47 | Ga0466707_120114 | 3300042601 | Bacteria | 29192 |
| 48 | Ga0466717_090698 | 3300042604 | Bacteria | 6047 |
| 49 | Ga0466719_357063 | 3300042606 | Bacteria | 4468 |
| 50 | Ga0466720_068143 | 3300042607 | Bacteria | 30497 |
| 51 | Ga0466724_30782 | 3300042649 | Bacteria | 270519 |
| 52 | Ga0466708_062149 | 3300042652 | Bacteria | 14908 |
| 53 | Ga0466712_042970 | 3300042614 | Bacteria | 2577 |
| 54 | Ga0466726_073596 | 3300042619 | Bacteria | 7396 |
| 55 | Ga0466726_076659 | 3300042619 | Bacteria | 16759 |
| 56 | Ga0466692_163033 | 3300042591 | Bacteria | 1321 |
| 57 | Ga0123353_10150402 | 3300010167 | Bacteria | 3718 |
| 58 | Ga0123353_10565397 | 3300010167 | Bacteria | 1636 |
| 59 | AustNasuHG_c1000173 | 3300000089 | Bacteria | 20878 |
| 60 | JGI24698J34947_10122480 | 3300002449 | Bacteria | 1126 |
| 61 | Ga0466718_078373 | 3300042617 | Bacteria | 3225 |
| 62 | Ga0415639_052228 | 3300038395 | Bacteria | 3361 |
| 63 | Ga0123356_10557827 | 3300010049 | Bacteria | 1307 |
| 64 | Ga0123353_10106061 | 3300010167 | Bacteria | 4528 |
| 65 | Ga0123353_10357405 | 3300010167 | Bacteria | 2197 |
| 66 | JGI24705J35276_12238619 | 3300002504 | Bacteria | 29895 |
| 67 | Ga0074263_108262 | 3300005485 | Bacteria | 1646 |
| 68 | Ga0074263_113657 | 3300005485 | Bacteria | 1905 |
| 69 | Ga0466701_066225 | 3300042598 | Bacteria | 1163 |
| 70 | Ga0466700_456158 | 3300042600 | Bacteria | 7205 |
| 71 | Ga0466707_219977 | 3300042601 | Bacteria | 1826 |
| 72 | Ga0466722_263275 | 3300042609 | Bacteria | 25945 |
| 73 | Ga0466698_455349 | 3300042610 | Bacteria | 1477 |
| 74 | Ga0466727_145325 | 3300042655 | Bacteria | 108337 |
| 75 | Ga0466726_282981 | 3300042619 | Bacteria | 1492 |
| 76 | Ga0466690_290463 | 3300042590 | Bacteria | 10253 |
| 77 | Ga0466693_177110 | 3300042592 | Bacteria | 1168 |
| 78 | Ga0466694_312671 | 3300042594 | Archaea | 1038 |
| 79 | Ga0466696_285584 | 3300042596 | Bacteria | 2383 |
| 80 | Ga0466699_294058 | 3300042597 | Bacteria | 27296 |
| 81 | Ga0123356_10238769 | 3300010049 | Archaea | 1887 |
| 82 | JGI24698J34947_10017137 | 3300002449 | Archaea | 3929 |
| 83 | JGI24698J34947_10019259 | 3300002449 | Bacteria | 3685 |
| 84 | Ga0072941_1012053 | 3300005201 | Bacteria | 14304 |
| 85 | Ga0466731_229029 | 3300042622 | Bacteria | 4864 |
| 86 | Ga0466727_047613 | 3300042655 | Bacteria | 7249 |
| 87 | Ga0466733_169804 | 3300042659 | Bacteria | 5785 |
| 88 | Ga0466718_073445 | 3300042617 | Bacteria | 3835 |
| 89 | Ga0123355_10299220 | 3300009826 | Bacteria | 2196 |
| 90 | Ga0123356_10009693 | 3300010049 | Bacteria | 9498 |
| 91 | Ga0123353_10353350 | 3300010167 | Bacteria | 2213 |
| 92 | Ga0123353_10819826 | 3300010167 | Bacteria | 1281 |
| 93 | AustNasuHG_c1037873 | 3300000089 | Bacteria | 1224 |
| 94 | JGI24698J34947_10000475 | 3300002449 | Bacteria | 18798 |
| 95 | JGI24698J34947_10052146 | 3300002449 | Bacteria | 2054 |
| 96 | Ga0068305_10046263 | 3300005083 | Bacteria | 11107 |
| 97 | Ga0072941_1018832 | 3300005201 | Bacteria | 14983 |
| 98 | Ga0466706_030503 | 3300042599 | Bacteria | 7425 |
| 99 | Ga0466700_281331 | 3300042600 | Bacteria | 2822 |
| 100 | Ga0466722_034998 | 3300042609 | Bacteria | 22256 |
| 101 | Ga0466702_005468 | 3300042635 | Bacteria | 5349 |
| 102 | Ga0466702_393078 | 3300042635 | Bacteria | 2520 |
| 103 | Ga0466704_120076 | 3300042643 | Bacteria | 22375 |
| 104 | Ga0466727_053352 | 3300042655 | Bacteria | 26992 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00490 | ALAD | Delta-aminolevulinic acid dehydratase | 41 | 349 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.