Protein Family IF08913

Metagenome Metatranscriptome Isolate
151 Members
95 Samples
106 Scaffolds
205.84 Avg Length

🧬 Representative Sequence

ID
3300042625|Ga0466730_023397|Ga0466730_023397_1021_1698
Length
225 aa
Sequence
MERNTKGVLGTKLGMSQVFDDQGRIVPVTVVKAGPCVVTAVRTPERDGYAGVQLGYGEIDPRKVTKPVAGHFTAAGVTPRRYLAELRTSDASEYTLGQEVTAEVFAPGQLVDVTGKSKGKGTAGVVKRHGFRGLSASHGTQRKHRAPGSIGGCATPGRVFKGLRMAGRMGSERVTVQSLTVHAVDAERGLLLIKGAVPGSPGGLVLVRSAAKAPAGVATSAEGAG

📊 Sample Types

Isolate 29.8%
Metagenome 68.9%
MAG 0.0%
Metatranscriptome 1.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.8%
Unclassified 21.3%
Kalotermitidae 11.2%
Tenebrionidae 9.0%
Culicidae 5.6%
Termopsidae 4.5%
Formicidae 4.5%
Scarabaeidae 3.4%
Cambaridae 3.4%
Rhinotermitidae 2.2%
Hydrophilidae 2.2%
Armadillidiidae 2.2%
Curculionidae 1.1%
Hodotermitidae 1.1%
Pyralidae 1.1%
Siricidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
2 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
3 2896955351 Streptomyces sp. GF20 Isolate Termitidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
7 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
8 8073544309 Actinomadura sp. RB99 Isolate Termitidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
13 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
14 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
15 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
18 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
19 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
20 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
21 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
27 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
28 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
31 8062637095 Yimella sp. cx-51 Isolate Cambaridae
32 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
33 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
34 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
40 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
41 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
42 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
43 2909412500 Yimella sp. cx-573 Isolate Cambaridae
44 2931430189 Tessaracoccus palaemonis J1M15 Isolate
45 3300060774 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
46 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
47 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
48 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
49 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
50 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
51 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
52 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
53 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
54 2900368070 Nocardia aurantia RB56 Isolate Termitidae
55 2912749649 Streptomyces sp. GS7 Isolate Termitidae
56 8062747827 Yimella sp. cx-51 Isolate Cambaridae
57 3006461590 Streptomyces sp. RB5 Isolate Termitidae
58 3006667155 Streptomyces sp. SID9727 Isolate
59 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
60 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
61 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
62 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
63 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
64 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
65 2908241010 Streptomyces sp. HF10 Isolate Termitidae
66 2912817845 Streptomyces griseus SID164 Isolate
67 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
68 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
69 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
70 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
71 3006468911 Streptomyces sp. RB17 Isolate Termitidae
72 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
73 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
74 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
75 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
76 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
77 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
78 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
79 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
80 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
81 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
82 2873603790 Tessaracoccus coleopterorum HDW20 Isolate Hydrophilidae
83 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
84 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
85 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
86 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
87 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
88 2547132081 Streptomyces sp. S4 Isolate Formicidae
89 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
90 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
91 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
92 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
93 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
94 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
95 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562378_2407 3300056814 Unclassified 15648
2 Ga0562375_0569 3300056856 Bacteria 72979
3 Ga0562376_0007 3300056857 Bacteria 1429637
4 Ga0562376_0418 3300056857 Bacteria 79667
5 Ga0590798_01403 3300060774 Unclassified 1970
6 Ga0466729_243078 3300042621 Bacteria 1508
7 Ga0466734_086470 3300042623 Bacteria 2112
8 Ga0466730_066804 3300042625 Unclassified 1042
9 Ga0160435_1001144 3300012857 Bacteria 6896
10 Ga0415639_095019 3300038395 Bacteria 3384
11 Ga0466696_320011 3300042596 Bacteria 10233
12 Ga0123354_10008932 3300010882 Bacteria 15296
13 Ga0123354_10315889 3300010882 Unclassified 1450
14 Ga0160442_100065 3300012806 Bacteria 144556
15 Ga0466713_156493 3300042602 Bacteria 2330
16 Ga0072940_1253174 3300005200 Bacteria 852
17 Ga0123357_10001625 3300009784 Bacteria 24088
18 Ga0123357_10001723 3300009784 Bacteria 23593
19 Ga0466715_562604 3300042616 Bacteria 3932
20 Ga0562377_0161 3300056842 Bacteria 189060
21 Ga0466735_162252 3300042624 Bacteria 2196
22 Ga0466730_017240 3300042625 Bacteria 1175
23 Ga0466730_055821 3300042625 Bacteria 8238
24 Ga0466727_119340 3300042655 Bacteria 6208
25 Ga0160447_112728 3300012849 Bacteria 1695
26 Ga0123357_10066173 3300009784 Unclassified 4822
27 Ga0123356_10026024 3300010049 Bacteria 5499
28 Ga0123353_10192274 3300010167 Bacteria 3220
29 Ga0466706_185014 3300042599 Bacteria 3626
30 Ga0466707_351878 3300042601 Bacteria 23367
31 Ga0466715_134740 3300042616 Bacteria 2266
32 Ga0466723_189940 3300042618 Bacteria 29161
33 Ga0562379_0191 3300056790 Bacteria 175707
34 Ga0562377_2598 3300056842 Bacteria 12848
35 Ga0466730_023397 3300042625 Bacteria 2005
36 Ga0123355_10490746 3300009826 Bacteria 1521
37 Ga0123354_10022573 3300010882 Bacteria 9921
38 Ga0123354_10118732 3300010882 Unclassified 3431
39 Ga0466707_086104 3300042601 Bacteria 138731
40 Ga0466722_112981 3300042609 Bacteria 1519
41 Ga0123357_10000640 3300009784 Bacteria 34769
42 Ga0466705_402140 3300042612 Bacteria 1008
43 Ga0466710_175050 3300042613 Bacteria 1523
44 Ga0466711_068649 3300042615 Bacteria 1206
45 Ga0562376_0002 3300056857 Bacteria 3502070
46 Ga0562376_0281 3300056857 Bacteria 101378
47 Ga0466703_325455 3300042636 Bacteria 14564
48 Ga0466725_000130 3300042654 Bacteria 1478
49 Ga0160430_119511 3300012852 Bacteria 953
50 Ga0466691_012570 3300042593 Bacteria 32910
51 Ga0466707_421729 3300042601 Bacteria 13878
52 Ga0068302_10010595 3300005071 Unclassified 1195
53 Ga0466718_152904 3300042617 Bacteria 12214
54 Ga0466705_371630 3300042612 Bacteria 1902
55 Ga0562375_0042 3300056856 Bacteria 527811
56 Ga0466708_205008 3300042652 Bacteria 28180
57 Ga0160455_103445 3300012837 Bacteria 2415
58 Ga0160430_121492 3300012852 Bacteria 882
59 Ga0160457_1000057 3300012858 Bacteria 180491
60 Ga0123357_10297225 3300009784 Bacteria 1638
61 Ga0123356_10025041 3300010049 Bacteria 5609
62 Ga0123354_10002396 3300010882 Bacteria 24675
63 Ga0466706_047001 3300042599 Bacteria 29829
64 Ga0466707_046235 3300042601 Bacteria 2048
65 Ga0123357_10000801 3300009784 Bacteria 31843
66 Ga0123357_10003044 3300009784 Bacteria 19002
67 Ga0466723_043574 3300042618 Bacteria 14699
68 Ga0466723_160743 3300042618 Bacteria 1276
69 Ga0466723_319227 3300042618 Bacteria 1479
70 Ga0562374_2901 3300057007 Unclassified 12325
71 Ga0466730_023907 3300042625 Unclassified 12809
72 Ga0466703_144605 3300042636 Bacteria 9715
73 Ga0160447_106657 3300012849 Bacteria 3023
74 Ga0123357_10275603 3300009784 Bacteria 1748
75 Ga0123353_10265637 3300010167 Unclassified 2648
76 Ga0466722_198999 3300042609 Bacteria 1238
77 Ga0466711_253939 3300042615 Bacteria 18586
78 Ga0466705_343361 3300042612 Bacteria 14966
79 Ga0590775_07978 3300060896 Bacteria 1525
80 Ga0466730_064112 3300042625 Bacteria 1156
81 Ga0466727_280039 3300042655 Bacteria 1114
82 Ga0160458_105346 3300012832 Unclassified 1528
83 Ga0466696_350585 3300042596 Bacteria 3349
84 Ga0123357_10475116 3300009784 Unclassified 1061
85 Ga0123353_10000701 3300010167 Bacteria 40961
86 Ga0123353_10917083 3300010167 Bacteria 1190
87 Ga0466719_350968 3300042606 Bacteria 1496
88 Ga0466722_155738 3300042609 Bacteria 28782
89 Ga0123357_10001429 3300009784 Bacteria 25338
90 Ga0466710_208321 3300042613 Bacteria 11430
91 Ga0466697_143551 3300042611 Bacteria 2381
92 Ga0562375_3766 3300056856 Bacteria 13275
93 Ga0562376_0223 3300056857 Bacteria 114445
94 Ga0466730_007810 3300042625 Bacteria 11605
95 Ga0466704_109485 3300042643 Bacteria 14274
96 Ga0466704_582723 3300042643 Bacteria 43560
97 Ga0466724_64838 3300042649 Bacteria 17323
98 Ga0466708_171991 3300042652 Bacteria 11415
99 Ga0160432_104610 3300012818 Bacteria 1502
100 Ga0160446_100161 3300012835 Bacteria 52061
101 Ga0160446_102520 3300012835 Unclassified 3184
102 Ga0123353_10442229 3300010167 Bacteria 1917
103 Ga0466713_145633 3300042602 Bacteria 1791
104 Ga0123357_10002532 3300009784 Bacteria 20451
105 Ga0466711_009545 3300042615 Bacteria 1231
106 Ga0466726_207676 3300042619 Bacteria 2654

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00297 Ribosomal_L3 Ribosomal protein L3 98 184 0.84

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.