Protein Family IF08838
Metagenome
Isolate
112
Members
48
Samples
108
Scaffolds
201.78
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_200864|Ga0466735_200864_72_698
- Length
- 208 aa
- Sequence
- MVEVEIMLIKLYNENPNIKDITKVVHILKDGGIIIYPTDTVYAMGCDALNVRAVEKICKIKGINPTKSNLSIICPDMSNISEYGKVTNQIFKLMKRNLPGPFTFILNATNNLPKIYKNRKEVGIRIPDNNIILTLVKELGNPILTTSVRDRDDILEYCTDPELIDEAYGDKVDAVIDGGYGGIEPSTIVDCTGETVLVSRQGKGVLRE
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.3%
Kalotermitidae
27.7%
Unclassified
10.6%
Termopsidae
8.5%
Rhinotermitidae
6.4%
Passalidae
4.3%
Blattidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 19 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 20 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10018736 | 3300009784 | Bacteria | 9210 |
| 2 | Ga0123357_10039832 | 3300009784 | Bacteria | 6398 |
| 3 | Ga0466692_071441 | 3300042591 | Bacteria | 25339 |
| 4 | Ga0466707_129169 | 3300042601 | Bacteria | 8592 |
| 5 | Ga0466707_283325 | 3300042601 | Bacteria | 2290 |
| 6 | 2227197783 | 2225789004 | Bacteria | 1447 |
| 7 | IMNBL1DRAFT_c0008402 | 3300000062 | Bacteria | 5258 |
| 8 | JGI24695J34938_10199567 | 3300002450 | Bacteria | 833 |
| 9 | JGI24702J35022_10002099 | 3300002462 | Bacteria | 12302 |
| 10 | JGI24705J35276_11874796 | 3300002504 | Bacteria | 732 |
| 11 | Ga0072941_1320002 | 3300005201 | Bacteria | 2682 |
| 12 | Ga0466727_049653 | 3300042655 | Bacteria | 8264 |
| 13 | Ga0466727_125799 | 3300042655 | Bacteria | 12931 |
| 14 | Ga0466705_526893 | 3300042612 | Bacteria | 13073 |
| 15 | Ga0466715_194737 | 3300042616 | Bacteria | 10285 |
| 16 | Ga0466715_506203 | 3300042616 | Bacteria | 6197 |
| 17 | Ga0466700_018687 | 3300042600 | Bacteria | 1790 |
| 18 | Ga0466700_076968 | 3300042600 | Bacteria | 4049 |
| 19 | Ga0466713_101459 | 3300042602 | Bacteria | 26532 |
| 20 | Ga0466713_120712 | 3300042602 | Bacteria | 8696 |
| 21 | Ga0466719_497604 | 3300042606 | Bacteria | 6195 |
| 22 | IMNBL1DRAFT_c0012226 | 3300000062 | Bacteria | 3943 |
| 23 | Ga0466735_026571 | 3300042624 | Bacteria | 2732 |
| 24 | Ga0466735_038846 | 3300042624 | Bacteria | 2935 |
| 25 | Ga0466727_101219 | 3300042655 | Bacteria | 84035 |
| 26 | Ga0123354_10001131 | 3300010882 | Bacteria | 31107 |
| 27 | Ga0123354_10123141 | 3300010882 | Bacteria | 3332 |
| 28 | Ga0123354_10365402 | 3300010882 | Bacteria | 1266 |
| 29 | Ga0466696_332019 | 3300042596 | Bacteria | 1475 |
| 30 | Ga0466723_007609 | 3300042618 | Bacteria | 10027 |
| 31 | Ga0466713_059345 | 3300042602 | Bacteria | 29151 |
| 32 | Ga0466719_176141 | 3300042606 | Bacteria | 20840 |
| 33 | JGI24699J35502_11134046 | 3300002509 | Bacteria | 26730 |
| 34 | JGI24696J40584_12956264 | 3300002834 | Bacteria | 3061 |
| 35 | Ga0466729_242019 | 3300042621 | Bacteria | 6005 |
| 36 | Ga0466735_020832 | 3300042624 | Bacteria | 1498 |
| 37 | Ga0466727_138496 | 3300042655 | Bacteria | 6864 |
| 38 | Ga0123357_10030426 | 3300009784 | Bacteria | 7318 |
| 39 | Ga0123355_10300345 | 3300009826 | Bacteria | 2190 |
| 40 | Ga0123356_10064119 | 3300010049 | Bacteria | 3434 |
| 41 | Ga0123356_11807196 | 3300010049 | Bacteria | 760 |
| 42 | Ga0123354_10000260 | 3300010882 | Bacteria | 47442 |
| 43 | Ga0123354_10004820 | 3300010882 | Bacteria | 19303 |
| 44 | Ga0466692_195511 | 3300042591 | Bacteria | 2600 |
| 45 | Ga0466705_455162 | 3300042612 | Bacteria | 3219 |
| 46 | Ga0466728_343939 | 3300042620 | Bacteria | 1716 |
| 47 | Ga0466706_048730 | 3300042599 | Bacteria | 101759 |
| 48 | Ga0466700_419351 | 3300042600 | Bacteria | 22548 |
| 49 | JGI24699J35502_11120362 | 3300002509 | Bacteria | 3245 |
| 50 | Ga0466729_221059 | 3300042621 | Bacteria | 5928 |
| 51 | Ga0466734_106813 | 3300042623 | Bacteria | 2252 |
| 52 | Ga0123357_10237186 | 3300009784 | Bacteria | 1984 |
| 53 | Ga0466696_022640 | 3300042596 | Bacteria | 8337 |
| 54 | Ga0466723_033114 | 3300042618 | Bacteria | 3076 |
| 55 | Ga0466723_081192 | 3300042618 | Bacteria | 3766 |
| 56 | Ga0123357_10002433 | 3300009784 | Bacteria | 20774 |
| 57 | Ga0466729_201709 | 3300042621 | Bacteria | 34471 |
| 58 | Ga0466703_050101 | 3300042636 | Bacteria | 5056 |
| 59 | Ga0466709_127753 | 3300042648 | Bacteria | 16389 |
| 60 | Ga0466727_138272 | 3300042655 | Bacteria | 1747 |
| 61 | Ga0466705_309224 | 3300042612 | Bacteria | 5751 |
| 62 | Ga0123354_10244472 | 3300010882 | Bacteria | 1836 |
| 63 | Ga0466691_045583 | 3300042593 | Bacteria | 8332 |
| 64 | Ga0466694_293180 | 3300042594 | Bacteria | 1917 |
| 65 | Ga0466715_435471 | 3300042616 | Bacteria | 2853 |
| 66 | Ga0466726_295132 | 3300042619 | Bacteria | 5591 |
| 67 | Ga0466726_434997 | 3300042619 | Bacteria | 13449 |
| 68 | Ga0466729_086996 | 3300042621 | Bacteria | 6044 |
| 69 | Ga0466700_322673 | 3300042600 | Bacteria | 5793 |
| 70 | Ga0466707_129012 | 3300042601 | Bacteria | 3450 |
| 71 | Ga0466707_179990 | 3300042601 | Bacteria | 21609 |
| 72 | Ga0466722_040193 | 3300042609 | Bacteria | 6850 |
| 73 | Ga0466698_018074 | 3300042610 | Bacteria | 1061 |
| 74 | IMNBL1DRAFT_c0000432 | 3300000062 | Bacteria | 35220 |
| 75 | JGI24699J35502_11133498 | 3300002509 | Bacteria | 11170 |
| 76 | Ga0068302_10320723 | 3300005071 | Bacteria | 4506 |
| 77 | Ga0466735_103595 | 3300042624 | Bacteria | 11990 |
| 78 | Ga0466735_200864 | 3300042624 | Bacteria | 1670 |
| 79 | Ga0466704_457197 | 3300042643 | Unclassified | 4927 |
| 80 | Ga0466708_295001 | 3300042652 | Bacteria | 12213 |
| 81 | Ga0123357_10022167 | 3300009784 | Bacteria | 8511 |
| 82 | Ga0123354_10332188 | 3300010882 | Bacteria | 1384 |
| 83 | Ga0466690_103364 | 3300042590 | Bacteria | 7999 |
| 84 | Ga0466696_076040 | 3300042596 | Bacteria | 4755 |
| 85 | Ga0466711_199870 | 3300042615 | Bacteria | 28300 |
| 86 | Ga0466715_376224 | 3300042616 | Bacteria | 43713 |
| 87 | Ga0466719_169796 | 3300042606 | Bacteria | 3963 |
| 88 | Ga0466719_371923 | 3300042606 | Bacteria | 7929 |
| 89 | JGI24699J35502_11134094 | 3300002509 | Bacteria | 30062 |
| 90 | Ga0466735_008243 | 3300042624 | Bacteria | 8506 |
| 91 | Ga0466703_034859 | 3300042636 | Bacteria | 7872 |
| 92 | Ga0466703_186467 | 3300042636 | Bacteria | 3521 |
| 93 | Ga0466703_252736 | 3300042636 | Bacteria | 4498 |
| 94 | Ga0466708_095257 | 3300042652 | Bacteria | 18757 |
| 95 | Ga0466725_376344 | 3300042654 | Bacteria | 1351 |
| 96 | Ga0123356_11212824 | 3300010049 | Bacteria | 920 |
| 97 | Ga0123353_11170514 | 3300010167 | Bacteria | 1012 |
| 98 | Ga0466693_218376 | 3300042592 | Bacteria | 2158 |
| 99 | Ga0466693_398785 | 3300042592 | Bacteria | 1533 |
| 100 | Ga0466691_029447 | 3300042593 | Bacteria | 5890 |
| 101 | Ga0466701_014044 | 3300042598 | Bacteria | 30629 |
| 102 | Ga0466710_104679 | 3300042613 | Bacteria | 2449 |
| 103 | Ga0466701_088409 | 3300042598 | Bacteria | 49099 |
| 104 | Ga0466700_048707 | 3300042600 | Bacteria | 13808 |
| 105 | Ga0466707_240218 | 3300042601 | Bacteria | 1542 |
| 106 | JGI24695J34938_10028662 | 3300002450 | Bacteria | 2613 |
| 107 | JGI24702J35022_10010611 | 3300002462 | Bacteria | 5145 |
| 108 | Ga0466735_149669 | 3300042624 | Bacteria | 1162 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01300 | Sua5_yciO_yrdC | Telomere recombination | 27 | 202 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01300 | GO:0003725 | double-stranded RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.