Protein Family IF08813
Metagenome
Isolate
116
Members
35
Samples
108
Scaffolds
179.97
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_151072|Ga0466735_151072_258_809
- Length
- 183 aa
- Sequence
- MNEFADMEILSISEEMDKVIQGLENEFSAVRTGRPNINILNKVTVNYYGTQTSLRQIANVNVADGTTLVIKPYEKSMLKEIESGINKANIGLPMTNDGVIIRMIFPVLTTERRKELIKTCEKVCENFKITIRNLRRDANDKIVKFGLSEDDERGYLADVQELTNKFITKTEVLLEKKKEEILK
Sample Types
Isolate
6.9%
Metagenome
93.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Unclassified
25.7%
Kalotermitidae
11.4%
Termopsidae
8.6%
Passalidae
5.7%
Hodotermitidae
2.9%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 3 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 4 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 5 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 21 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_047819 | 3300038395 | Bacteria | 999 |
| 2 | Ga0466693_136108 | 3300042592 | Bacteria | 1192 |
| 3 | Ga0466706_266965 | 3300042599 | Bacteria | 47861 |
| 4 | Ga0123355_10009009 | 3300009826 | Bacteria | 15126 |
| 5 | Ga0123356_10011873 | 3300010049 | Bacteria | 8478 |
| 6 | Ga0123356_10083216 | 3300010049 | Bacteria | 3031 |
| 7 | Ga0123356_10606374 | 3300010049 | Bacteria | 1260 |
| 8 | Ga0123353_10120721 | 3300010167 | Bacteria | 4214 |
| 9 | Ga0123353_10174890 | 3300010167 | Unclassified | 3405 |
| 10 | Ga0123353_10182887 | 3300010167 | Bacteria | 3316 |
| 11 | Ga0123353_10293559 | 3300010167 | Bacteria | 2487 |
| 12 | Ga0123353_10932853 | 3300010167 | Bacteria | 1177 |
| 13 | Ga0466727_119956 | 3300042655 | Bacteria | 1350 |
| 14 | JGI24702J35022_10015760 | 3300002462 | Bacteria | 4152 |
| 15 | JGI24702J35022_10609167 | 3300002462 | Bacteria | 676 |
| 16 | JGI24705J35276_12012230 | 3300002504 | Bacteria | 863 |
| 17 | Ga0415639_243870 | 3300038395 | Bacteria | 1029 |
| 18 | Ga0466693_294499 | 3300042592 | Bacteria | 1257 |
| 19 | Ga0123355_10009151 | 3300009826 | Bacteria | 15026 |
| 20 | Ga0123356_10101473 | 3300010049 | Bacteria | 2761 |
| 21 | Ga0123353_10021907 | 3300010167 | Bacteria | 9607 |
| 22 | Ga0123353_10926248 | 3300010167 | Bacteria | 1182 |
| 23 | Ga0466704_215495 | 3300042643 | Bacteria | 11762 |
| 24 | 2227436365 | 2225789004 | Unclassified | 1030 |
| 25 | JGI24695J34938_10019341 | 3300002450 | Bacteria | 3378 |
| 26 | JGI24702J35022_10000049 | 3300002462 | Bacteria | 50932 |
| 27 | JGI24702J35022_10040264 | 3300002462 | Bacteria | 2492 |
| 28 | JGI24702J35022_10050919 | 3300002462 | Bacteria | 2207 |
| 29 | Ga0466694_235284 | 3300042594 | Bacteria | 3178 |
| 30 | Ga0123355_10007574 | 3300009826 | Bacteria | 16291 |
| 31 | Ga0123356_10191290 | 3300010049 | Bacteria | 2078 |
| 32 | Ga0123356_10282350 | 3300010049 | Bacteria | 1756 |
| 33 | Ga0123356_10479797 | 3300010049 | Bacteria | 1396 |
| 34 | Ga0123353_10065907 | 3300010167 | Bacteria | 5813 |
| 35 | Ga0123353_10083880 | 3300010167 | Bacteria | 5129 |
| 36 | Ga0123353_10384865 | 3300010167 | Bacteria | 2096 |
| 37 | Ga0123353_10432774 | 3300010167 | Bacteria | 1945 |
| 38 | Ga0123353_11262699 | 3300010167 | Bacteria | 963 |
| 39 | Ga0123354_10419781 | 3300010882 | Bacteria | 1113 |
| 40 | Ga0466726_488926 | 3300042619 | Bacteria | 1552 |
| 41 | Ga0466735_225355 | 3300042624 | Bacteria | 3332 |
| 42 | JGI24695J34938_10032193 | 3300002450 | Bacteria | 2425 |
| 43 | JGI24702J35022_10000022 | 3300002462 | Bacteria | 61888 |
| 44 | JGI24696J40584_12834963 | 3300002834 | Bacteria | 939 |
| 45 | Ga0466697_049682 | 3300042611 | Bacteria | 1550 |
| 46 | Ga0123355_10319192 | 3300009826 | Bacteria | 2095 |
| 47 | Ga0123356_10001518 | 3300010049 | Bacteria | 25566 |
| 48 | Ga0123356_10441338 | 3300010049 | Bacteria | 1448 |
| 49 | Ga0123353_10007246 | 3300010167 | Bacteria | 14950 |
| 50 | Ga0123353_10021537 | 3300010167 | Bacteria | 9678 |
| 51 | Ga0123353_10380094 | 3300010167 | Bacteria | 2113 |
| 52 | Ga0123353_10478208 | 3300010167 | Bacteria | 1824 |
| 53 | Ga0123353_10708456 | 3300010167 | Bacteria | 1411 |
| 54 | Ga0123353_10900108 | 3300010167 | Bacteria | 1205 |
| 55 | Ga0123353_11088218 | 3300010167 | Bacteria | 1063 |
| 56 | Ga0466726_359015 | 3300042619 | Bacteria | 1310 |
| 57 | Ga0466735_068124 | 3300042624 | Bacteria | 22267 |
| 58 | Ga0466735_151072 | 3300042624 | Bacteria | 2785 |
| 59 | Ga0466696_391586 | 3300042596 | Bacteria | 7420 |
| 60 | Ga0466706_020843 | 3300042599 | Bacteria | 32958 |
| 61 | Ga0466706_057690 | 3300042599 | Bacteria | 1804 |
| 62 | Ga0466707_257575 | 3300042601 | Bacteria | 49216 |
| 63 | Ga0123355_10000084 | 3300009826 | Bacteria | 98802 |
| 64 | Ga0123356_10014757 | 3300010049 | Bacteria | 7504 |
| 65 | Ga0123353_10003338 | 3300010167 | Bacteria | 20255 |
| 66 | Ga0123353_10046006 | 3300010167 | Bacteria | 6930 |
| 67 | Ga0123353_10243794 | 3300010167 | Bacteria | 2790 |
| 68 | Ga0123353_10274297 | 3300010167 | Bacteria | 2595 |
| 69 | Ga0123353_10293062 | 3300010167 | Bacteria | 2489 |
| 70 | Ga0123353_10425024 | 3300010167 | Unclassified | 1967 |
| 71 | Ga0123353_10809192 | 3300010167 | Bacteria | 1292 |
| 72 | Ga0123353_11575581 | 3300010167 | Bacteria | 831 |
| 73 | Ga0466735_187511 | 3300042624 | Unclassified | 1719 |
| 74 | 2227641274 | 2225789004 | Bacteria | 11066 |
| 75 | Ga0466705_162750 | 3300042612 | Bacteria | 11804 |
| 76 | Ga0466719_128075 | 3300042606 | Bacteria | 5694 |
| 77 | Ga0123355_10000855 | 3300009826 | Bacteria | 42029 |
| 78 | Ga0123356_10498262 | 3300010049 | Bacteria | 1374 |
| 79 | Ga0123353_10097277 | 3300010167 | Bacteria | 4743 |
| 80 | Ga0123353_10150437 | 3300010167 | Bacteria | 3717 |
| 81 | Ga0123353_10236904 | 3300010167 | Unclassified | 2840 |
| 82 | Ga0123353_10292823 | 3300010167 | Unclassified | 2491 |
| 83 | Ga0123353_10305568 | 3300010167 | Bacteria | 2425 |
| 84 | Ga0123353_10500701 | 3300010167 | Bacteria | 1770 |
| 85 | Ga0123353_10725752 | 3300010167 | Bacteria | 1389 |
| 86 | Ga0123353_10851507 | 3300010167 | Bacteria | 1249 |
| 87 | Ga0466726_093973 | 3300042619 | Bacteria | 1057 |
| 88 | Ga0466735_224054 | 3300042624 | Bacteria | 22407 |
| 89 | Ga0466725_405727 | 3300042654 | Bacteria | 1492 |
| 90 | JGI24702J35022_10114564 | 3300002462 | Bacteria | 1484 |
| 91 | Ga0072940_1570474 | 3300005200 | Bacteria | 630 |
| 92 | Ga0466706_045085 | 3300042599 | Unclassified | 32184 |
| 93 | Ga0466700_472432 | 3300042600 | Bacteria | 2241 |
| 94 | Ga0123355_10028971 | 3300009826 | Bacteria | 8957 |
| 95 | Ga0123353_10022368 | 3300010167 | Bacteria | 9530 |
| 96 | Ga0123353_10027661 | 3300010167 | Bacteria | 8695 |
| 97 | Ga0123354_10379603 | 3300010882 | Bacteria | 1222 |
| 98 | Ga0466734_037194 | 3300042623 | Bacteria | 1022 |
| 99 | IMNBL1DRAFT_c0000003 | 3300000062 | Bacteria | 275310 |
| 100 | JGI24705J35276_12225913 | 3300002504 | Bacteria | 2783 |
| 101 | Ga0466707_355729 | 3300042601 | Bacteria | 1491 |
| 102 | Ga0123356_10038464 | 3300010049 | Bacteria | 4458 |
| 103 | Ga0123353_10136974 | 3300010167 | Unclassified | 3926 |
| 104 | Ga0123353_10578442 | 3300010167 | Bacteria | 1612 |
| 105 | Ga0123353_10600449 | 3300010167 | Bacteria | 1573 |
| 106 | Ga0466726_453615 | 3300042619 | Bacteria | 2092 |
| 107 | Ga0466725_286985 | 3300042654 | Bacteria | 1983 |
| 108 | Ga0466727_074948 | 3300042655 | Bacteria | 1063 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01765 | RRF | Ribosome recycling factor | 23 | 182 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.