Protein Family IF08778
Metagenome
Isolate
156
Members
53
Samples
149
Scaffolds
297.69
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_085051|Ga0466735_085051_455_1492
- Length
- 345 aa
- Sequence
- VQKYVFFSLKNGLRYKRLKKNILNKKNVSLQFINLIKKNRRNYMSITKLDQILALVKTKSKKRVVAAYANDEHTIQALYLAIQEGIVDATLVGDEPTIAAVCKAHNFDIQKFKIVQEADENRAGGVAVSLINRGEGDILMKGLLSTDKYMRAILNKENGLMPGGKAVLSHVTVIETPKYHKLIICGDVAIIPAPDLNQKIAIANYLIKTAHALEIKNPKVAVIAATEQMLAGMPACVDAAIISKMADRNQIKGAIVDGPFSLDLALDMESAQIKKMTSEVAGDADCLLFPNIESGNIFYKCNTKLAGGELGAMVMGAKVPCILTSRGDSAKTKMYSIALAALTAK
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.8%
Kalotermitidae
26.4%
Unclassified
18.9%
Termopsidae
7.5%
Rhinotermitidae
5.7%
Passalidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 15 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 50 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 51 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_103016 | 3300042659 | Bacteria | 6307 |
| 2 | Ga0466733_215393 | 3300042659 | Bacteria | 2475 |
| 3 | Ga0466705_496275 | 3300042612 | Bacteria | 9091 |
| 4 | Ga0466711_072994 | 3300042615 | Bacteria | 3875 |
| 5 | Ga0466723_063021 | 3300042618 | Bacteria | 19255 |
| 6 | Ga0123353_10290612 | 3300010167 | Bacteria | 2503 |
| 7 | Ga0466691_045556 | 3300042593 | Bacteria | 17407 |
| 8 | Ga0466696_010048 | 3300042596 | Bacteria | 35433 |
| 9 | Ga0466701_001178 | 3300042598 | Bacteria | 8236 |
| 10 | Ga0466704_499034 | 3300042643 | Bacteria | 46935 |
| 11 | Ga0466704_571048 | 3300042643 | Bacteria | 19058 |
| 12 | Ga0466709_094187 | 3300042648 | Bacteria | 75625 |
| 13 | Ga0466701_032729 | 3300042598 | Bacteria | 33089 |
| 14 | Ga0466707_411120 | 3300042601 | Bacteria | 3792 |
| 15 | Ga0466713_003097 | 3300042602 | Bacteria | 4564 |
| 16 | Ga0466714_108495 | 3300042603 | Bacteria | 1539 |
| 17 | Ga0466719_325427 | 3300042606 | Bacteria | 1522 |
| 18 | Ga0466722_053578 | 3300042609 | Bacteria | 8865 |
| 19 | Ga0466705_059486 | 3300042612 | Bacteria | 10161 |
| 20 | Ga0466733_111686 | 3300042659 | Bacteria | 1649 |
| 21 | Ga0466712_300862 | 3300042614 | Bacteria | 1124 |
| 22 | Ga0466711_434272 | 3300042615 | Bacteria | 3815 |
| 23 | Ga0466715_004531 | 3300042616 | Bacteria | 37567 |
| 24 | Ga0466723_179062 | 3300042618 | Bacteria | 9608 |
| 25 | Ga0466726_367347 | 3300042619 | Bacteria | 1547 |
| 26 | Ga0466728_120445 | 3300042620 | Unclassified | 1256 |
| 27 | Ga0466690_089517 | 3300042590 | Bacteria | 5773 |
| 28 | Ga0466690_091861 | 3300042590 | Bacteria | 8994 |
| 29 | Ga0466696_245977 | 3300042596 | Bacteria | 18314 |
| 30 | Ga0466735_085051 | 3300042624 | Bacteria | 2599 |
| 31 | Ga0466703_300757 | 3300042636 | Bacteria | 6211 |
| 32 | Ga0466709_041701 | 3300042648 | Bacteria | 32131 |
| 33 | Ga0466709_216743 | 3300042648 | Bacteria | 57156 |
| 34 | Ga0466708_199202 | 3300042652 | Bacteria | 16986 |
| 35 | Ga0466708_232096 | 3300042652 | Bacteria | 10708 |
| 36 | Ga0466706_021441 | 3300042599 | Bacteria | 78920 |
| 37 | Ga0466716_469531 | 3300042605 | Bacteria | 2461 |
| 38 | Ga0466719_445989 | 3300042606 | Bacteria | 3448 |
| 39 | Ga0466722_027014 | 3300042609 | Bacteria | 9008 |
| 40 | 2227483819 | 2225789004 | Bacteria | 4334 |
| 41 | Ga0466711_291747 | 3300042615 | Bacteria | 2939 |
| 42 | Ga0466723_136439 | 3300042618 | Unclassified | 2174 |
| 43 | Ga0466729_031450 | 3300042621 | Bacteria | 2046 |
| 44 | Ga0123353_10005558 | 3300010167 | Bacteria | 16577 |
| 45 | Ga0466690_080096 | 3300042590 | Bacteria | 3339 |
| 46 | Ga0466690_089421 | 3300042590 | Unclassified | 11731 |
| 47 | Ga0466690_305138 | 3300042590 | Bacteria | 11373 |
| 48 | Ga0466690_345687 | 3300042590 | Bacteria | 26516 |
| 49 | Ga0466692_020043 | 3300042591 | Bacteria | 3750 |
| 50 | Ga0466692_124213 | 3300042591 | Bacteria | 5701 |
| 51 | Ga0466691_032657 | 3300042593 | Bacteria | 10386 |
| 52 | Ga0466696_080985 | 3300042596 | Bacteria | 38621 |
| 53 | Ga0466703_187804 | 3300042636 | Bacteria | 11577 |
| 54 | Ga0466704_607630 | 3300042643 | Bacteria | 23830 |
| 55 | Ga0466727_039285 | 3300042655 | Bacteria | 5079 |
| 56 | Ga0466727_083036 | 3300042655 | Bacteria | 5986 |
| 57 | Ga0466713_038863 | 3300042602 | Bacteria | 2990 |
| 58 | Ga0466722_103228 | 3300042609 | Bacteria | 13192 |
| 59 | Ga0068302_10038238 | 3300005071 | Unclassified | 1635 |
| 60 | Ga0068305_10021076 | 3300005083 | Bacteria | 26083 |
| 61 | Ga0068305_10564122 | 3300005083 | Bacteria | 2605 |
| 62 | Ga0466705_054284 | 3300042612 | Bacteria | 22492 |
| 63 | Ga0466715_008731 | 3300042616 | Bacteria | 1990 |
| 64 | Ga0466715_009739 | 3300042616 | Bacteria | 69251 |
| 65 | Ga0466715_154042 | 3300042616 | Bacteria | 17029 |
| 66 | Ga0466715_263327 | 3300042616 | Bacteria | 12358 |
| 67 | Ga0466726_332421 | 3300042619 | Bacteria | 11158 |
| 68 | Ga0466728_043613 | 3300042620 | Bacteria | 6797 |
| 69 | Ga0466728_076470 | 3300042620 | Bacteria | 13064 |
| 70 | Ga0466728_086057 | 3300042620 | Bacteria | 7597 |
| 71 | Ga0466729_103195 | 3300042621 | Bacteria | 2398 |
| 72 | Ga0123355_10000308 | 3300009826 | Bacteria | 62784 |
| 73 | Ga0123355_10002877 | 3300009826 | Bacteria | 24450 |
| 74 | Ga0123353_10011017 | 3300010167 | Bacteria | 12693 |
| 75 | Ga0123353_10201507 | 3300010167 | Bacteria | 3130 |
| 76 | Ga0466690_105298 | 3300042590 | Bacteria | 2237 |
| 77 | Ga0466696_005733 | 3300042596 | Bacteria | 17522 |
| 78 | Ga0466696_215035 | 3300042596 | Bacteria | 4586 |
| 79 | Ga0466696_231982 | 3300042596 | Bacteria | 3493 |
| 80 | Ga0466699_008855 | 3300042597 | Bacteria | 1691 |
| 81 | Ga0466704_500113 | 3300042643 | Unclassified | 4803 |
| 82 | Ga0466709_204440 | 3300042648 | Bacteria | 87623 |
| 83 | Ga0466727_248912 | 3300042655 | Unclassified | 1887 |
| 84 | Ga0466706_209610 | 3300042599 | Bacteria | 69562 |
| 85 | Ga0466700_434979 | 3300042600 | Bacteria | 2379 |
| 86 | Ga0466719_401571 | 3300042606 | Bacteria | 16231 |
| 87 | Ga0466722_031905 | 3300042609 | Bacteria | 36244 |
| 88 | IMNBL1DRAFT_c0011283 | 3300000062 | Bacteria | 4189 |
| 89 | IMNBL1DRAFT_c0012113 | 3300000062 | Bacteria | 3969 |
| 90 | Ga0466726_469380 | 3300042619 | Bacteria | 2704 |
| 91 | Ga0466690_219540 | 3300042590 | Bacteria | 6967 |
| 92 | Ga0466693_106704 | 3300042592 | Unclassified | 2164 |
| 93 | Ga0466693_211907 | 3300042592 | Bacteria | 2296 |
| 94 | Ga0466691_003533 | 3300042593 | Unclassified | 8640 |
| 95 | Ga0466696_192329 | 3300042596 | Bacteria | 14138 |
| 96 | Ga0466703_051943 | 3300042636 | Bacteria | 6677 |
| 97 | Ga0466704_384308 | 3300042643 | Unclassified | 6130 |
| 98 | Ga0466727_097267 | 3300042655 | Bacteria | 11860 |
| 99 | Ga0466706_094835 | 3300042599 | Bacteria | 10682 |
| 100 | Ga0466706_127998 | 3300042599 | Bacteria | 35830 |
| 101 | JGI24696J40584_12934553 | 3300002834 | Unclassified | 1542 |
| 102 | Ga0466705_153484 | 3300042612 | Bacteria | 4965 |
| 103 | Ga0466711_208757 | 3300042615 | Bacteria | 7555 |
| 104 | Ga0466726_297632 | 3300042619 | Bacteria | 2721 |
| 105 | Ga0466728_444095 | 3300042620 | Bacteria | 3873 |
| 106 | Ga0466729_193514 | 3300042621 | Unclassified | 2310 |
| 107 | Ga0123353_10000426 | 3300010167 | Bacteria | 52111 |
| 108 | Ga0123354_10182204 | 3300010882 | Bacteria | 2392 |
| 109 | Ga0123354_10388637 | 3300010882 | Bacteria | 1195 |
| 110 | Ga0466694_341974 | 3300042594 | Bacteria | 2264 |
| 111 | Ga0466696_196254 | 3300042596 | Bacteria | 8673 |
| 112 | Ga0466709_003919 | 3300042648 | Bacteria | 4480 |
| 113 | Ga0466708_315337 | 3300042652 | Bacteria | 30097 |
| 114 | Ga0466722_045711 | 3300042609 | Bacteria | 6163 |
| 115 | 2227591288 | 2225789004 | Bacteria | 47425 |
| 116 | IMNBL1DRAFT_c0005512 | 3300000062 | Bacteria | 7211 |
| 117 | JGI24695J34938_10095139 | 3300002450 | Bacteria | 1220 |
| 118 | Ga0466705_196382 | 3300042612 | Bacteria | 3014 |
| 119 | Ga0466711_369231 | 3300042615 | Bacteria | 4425 |
| 120 | Ga0466726_215520 | 3300042619 | Bacteria | 2357 |
| 121 | Ga0466729_033136 | 3300042621 | Bacteria | 4311 |
| 122 | Ga0123356_10180909 | 3300010049 | Unclassified | 2130 |
| 123 | Ga0123353_10345359 | 3300010167 | Unclassified | 2246 |
| 124 | Ga0466695_049279 | 3300042595 | Bacteria | 12838 |
| 125 | Ga0466699_147511 | 3300042597 | Bacteria | 1394 |
| 126 | Ga0466708_174290 | 3300042652 | Bacteria | 6484 |
| 127 | Ga0466706_280624 | 3300042599 | Bacteria | 4091 |
| 128 | Ga0466713_102420 | 3300042602 | Bacteria | 24303 |
| 129 | Ga0466720_238349 | 3300042607 | Bacteria | 4570 |
| 130 | IMNBL1DRAFT_c0000751 | 3300000062 | Bacteria | 25684 |
| 131 | IMNBL1DRAFT_c0029545 | 3300000062 | Bacteria | 2025 |
| 132 | JGI24702J35022_10005226 | 3300002462 | Bacteria | 7610 |
| 133 | JGI24702J35022_10028431 | 3300002462 | Bacteria | 3004 |
| 134 | JGI24696J40584_12933164 | 3300002834 | Bacteria | 1515 |
| 135 | JGI24696J40584_12961064 | 3300002834 | Bacteria | 10394 |
| 136 | Ga0466710_099331 | 3300042613 | Bacteria | 1235 |
| 137 | Ga0466718_029861 | 3300042617 | Bacteria | 1657 |
| 138 | Ga0466726_282820 | 3300042619 | Bacteria | 2991 |
| 139 | Ga0466726_413685 | 3300042619 | Bacteria | 2124 |
| 140 | Ga0466690_112336 | 3300042590 | Bacteria | 10274 |
| 141 | Ga0466690_129976 | 3300042590 | Bacteria | 12172 |
| 142 | Ga0466693_023399 | 3300042592 | Unclassified | 1430 |
| 143 | Ga0466694_236083 | 3300042594 | Bacteria | 2621 |
| 144 | Ga0466703_265691 | 3300042636 | Bacteria | 4053 |
| 145 | Ga0466727_240889 | 3300042655 | Bacteria | 4631 |
| 146 | Ga0466706_169397 | 3300042599 | Bacteria | 4744 |
| 147 | IMNBL1DRAFT_c0007296 | 3300000062 | Bacteria | 5847 |
| 148 | JGI24696J40584_12873447 | 3300002834 | Unclassified | 1055 |
| 149 | JGI24696J40584_12961689 | 3300002834 | Bacteria | 37497 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01515 | PTA_PTB | Phosphate acetyl/butaryl transferase | 126 | 341 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01515 | GO:0016746 | acyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.