Protein Family IF08752
Metagenome
Isolate
184
Members
82
Samples
148
Scaffolds
105.65
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_056069|Ga0466735_056069_789_1175
- Length
- 128 aa
- Sequence
- MKEGCEFSQNIPYICPEFVKKSNMENDFLELEEQIVKMLKTVYDPEIPVNIYDLGLIYGVDVDDEKNALITMTLTAPACPAADFIMEDVKMRIESVPGIKSVEVKIVFEPEWSKDMMSEEAKLELGFL
Sample Types
Isolate
19.6%
Metagenome
80.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.3%
Termitidae
21.0%
Kalotermitidae
17.3%
Unclassified
11.1%
Termopsidae
4.9%
Rhinotermitidae
3.7%
Passalidae
2.5%
Hydrophilidae
1.2%
Hodotermitidae
1.2%
Drosophilidae
1.2%
Formicidae
1.2%
Kiwaidae
1.2%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 4 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 14 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 15 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 25 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 34 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 35 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 43 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 44 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 45 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 46 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 47 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 50 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 51 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 52 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 53 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 54 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 55 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 56 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 60 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 61 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 62 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 63 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 64 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 65 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 66 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 67 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 68 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 75 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 76 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 77 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 78 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 79 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 80 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 81 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 82 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_187814 | 3300042624 | Bacteria | 7364 |
| 2 | Ga0466704_095021 | 3300042643 | Bacteria | 8265 |
| 3 | Ga0466704_123694 | 3300042643 | Bacteria | 8289 |
| 4 | Ga0466709_417893 | 3300042648 | Bacteria | 2781 |
| 5 | Ga0466708_175500 | 3300042652 | Bacteria | 17846 |
| 6 | Ga0466700_009657 | 3300042600 | Bacteria | 4532 |
| 7 | Ga0466713_009546 | 3300042602 | Bacteria | 7786 |
| 8 | Ga0466713_055725 | 3300042602 | Bacteria | 54491 |
| 9 | Ga0466716_209317 | 3300042605 | Bacteria | 10900 |
| 10 | Ga0466715_287431 | 3300042616 | Bacteria | 4441 |
| 11 | Ga0466715_358275 | 3300042616 | Bacteria | 2210 |
| 12 | Ga0466691_174804 | 3300042593 | Bacteria | 4606 |
| 13 | Ga0466696_027471 | 3300042596 | Bacteria | 17440 |
| 14 | Ga0466696_411406 | 3300042596 | Bacteria | 4066 |
| 15 | Ga0466701_002423 | 3300042598 | Bacteria | 10005 |
| 16 | Ga0123357_10311675 | 3300009784 | Bacteria | 1570 |
| 17 | 2227236362 | 2225789004 | Bacteria | 7272 |
| 18 | 2227441904 | 2225789004 | Bacteria | 25895 |
| 19 | IMNBL1DRAFT_c0055589 | 3300000062 | Bacteria | 1219 |
| 20 | JGI24696J40584_12952120 | 3300002834 | Bacteria | 2311 |
| 21 | Ga0466733_046473 | 3300042659 | Bacteria | 56769 |
| 22 | Ga0466734_027699 | 3300042623 | Bacteria | 1779 |
| 23 | Ga0466735_030515 | 3300042624 | Bacteria | 2377 |
| 24 | Ga0466704_197346 | 3300042643 | Bacteria | 3773 |
| 25 | Ga0466704_297534 | 3300042643 | Bacteria | 10946 |
| 26 | Ga0466709_146467 | 3300042648 | Bacteria | 12165 |
| 27 | Ga0466711_397770 | 3300042615 | Bacteria | 2419 |
| 28 | Ga0466723_132207 | 3300042618 | Bacteria | 4023 |
| 29 | Ga0466726_092894 | 3300042619 | Bacteria | 13437 |
| 30 | Ga0123353_11526482 | 3300010167 | Bacteria | 849 |
| 31 | IMNBL1DRAFT_c0006309 | 3300000062 | Bacteria | 6504 |
| 32 | JGI24698J34947_10140237 | 3300002449 | Bacteria | 1019 |
| 33 | JGI24699J35502_11134211 | 3300002509 | Bacteria | 60442 |
| 34 | Ga0068302_10029390 | 3300005071 | Bacteria | 7940 |
| 35 | Ga0068305_10010315 | 3300005083 | Bacteria | 4234 |
| 36 | Ga0068305_10058085 | 3300005083 | Bacteria | 1721 |
| 37 | Ga0068305_10309964 | 3300005083 | Bacteria | 1427 |
| 38 | Ga0466705_217893 | 3300042612 | Unclassified | 1729 |
| 39 | Ga0466703_186069 | 3300042636 | Bacteria | 1059 |
| 40 | Ga0466703_236739 | 3300042636 | Bacteria | 2667 |
| 41 | Ga0466704_417401 | 3300042643 | Bacteria | 7074 |
| 42 | Ga0466704_503416 | 3300042643 | Bacteria | 12957 |
| 43 | Ga0466709_218633 | 3300042648 | Unclassified | 2924 |
| 44 | Ga0466725_432538 | 3300042654 | Bacteria | 27426 |
| 45 | Ga0466727_238759 | 3300042655 | Bacteria | 22004 |
| 46 | Ga0466706_051828 | 3300042599 | Bacteria | 24965 |
| 47 | Ga0466700_486430 | 3300042600 | Bacteria | 19114 |
| 48 | Ga0466707_022269 | 3300042601 | Bacteria | 8806 |
| 49 | Ga0466713_042446 | 3300042602 | Bacteria | 4672 |
| 50 | Ga0466713_046789 | 3300042602 | Bacteria | 28948 |
| 51 | Ga0466719_139313 | 3300042606 | Bacteria | 1376 |
| 52 | Ga0466719_363914 | 3300042606 | Bacteria | 4011 |
| 53 | Ga0466722_015712 | 3300042609 | Bacteria | 19629 |
| 54 | Ga0466711_136336 | 3300042615 | Bacteria | 4122 |
| 55 | Ga0466711_434363 | 3300042615 | Bacteria | 2531 |
| 56 | Ga0466715_567416 | 3300042616 | Bacteria | 16352 |
| 57 | Ga0466729_036998 | 3300042621 | Unclassified | 42864 |
| 58 | Ga0466690_258812 | 3300042590 | Bacteria | 4807 |
| 59 | 2227487445 | 2225789004 | Unclassified | 810 |
| 60 | IMNBL1DRAFT_c0001271 | 3300000062 | Bacteria | 19012 |
| 61 | JGI24695J34938_10044718 | 3300002450 | Bacteria | 1968 |
| 62 | Ga0068305_10015692 | 3300005083 | Bacteria | 23359 |
| 63 | Ga0102739_1000039 | 3300007095 | Bacteria | 37546 |
| 64 | Ga0466705_245960 | 3300042612 | Bacteria | 3325 |
| 65 | Ga0466735_040810 | 3300042624 | Bacteria | 1144 |
| 66 | Ga0466735_044533 | 3300042624 | Unclassified | 1669 |
| 67 | Ga0466704_247905 | 3300042643 | Bacteria | 30308 |
| 68 | Ga0466708_175681 | 3300042652 | Bacteria | 1625 |
| 69 | Ga0466727_106446 | 3300042655 | Bacteria | 6293 |
| 70 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 71 | Ga0466713_118123 | 3300042602 | Bacteria | 66356 |
| 72 | Ga0466723_305990 | 3300042618 | Bacteria | 29686 |
| 73 | Ga0466728_112248 | 3300042620 | Bacteria | 1419 |
| 74 | Ga0466690_047739 | 3300042590 | Bacteria | 9664 |
| 75 | Ga0466690_142707 | 3300042590 | Bacteria | 5920 |
| 76 | Ga0466693_281157 | 3300042592 | Bacteria | 1220 |
| 77 | Ga0466695_349431 | 3300042595 | Bacteria | 7123 |
| 78 | IMNBL1DRAFT_c0064323 | 3300000062 | Bacteria | 1086 |
| 79 | Ga0466735_010849 | 3300042624 | Bacteria | 2188 |
| 80 | Ga0466735_056069 | 3300042624 | Bacteria | 1465 |
| 81 | Ga0466735_142371 | 3300042624 | Bacteria | 4550 |
| 82 | Ga0466735_154266 | 3300042624 | Bacteria | 2200 |
| 83 | Ga0466735_166896 | 3300042624 | Unclassified | 3105 |
| 84 | Ga0466709_317906 | 3300042648 | Bacteria | 8591 |
| 85 | Ga0466708_251055 | 3300042652 | Bacteria | 27047 |
| 86 | Ga0466727_316564 | 3300042655 | Bacteria | 7041 |
| 87 | Ga0466707_178540 | 3300042601 | Bacteria | 3679 |
| 88 | Ga0466707_266825 | 3300042601 | Bacteria | 1598 |
| 89 | Ga0466707_346826 | 3300042601 | Bacteria | 5073 |
| 90 | Ga0466707_379788 | 3300042601 | Bacteria | 1000 |
| 91 | Ga0466713_010763 | 3300042602 | Bacteria | 24879 |
| 92 | Ga0466715_175294 | 3300042616 | Bacteria | 24622 |
| 93 | Ga0466693_304289 | 3300042592 | Bacteria | 1675 |
| 94 | Ga0466691_124639 | 3300042593 | Bacteria | 10282 |
| 95 | Ga0123356_10002943 | 3300010049 | Bacteria | 18030 |
| 96 | JGI24695J34938_10097145 | 3300002450 | Bacteria | 1205 |
| 97 | Ga0466705_267522 | 3300042612 | Bacteria | 42757 |
| 98 | Ga0466735_007014 | 3300042624 | Bacteria | 9392 |
| 99 | Ga0466703_289947 | 3300042636 | Bacteria | 14348 |
| 100 | Ga0466703_386239 | 3300042636 | Bacteria | 5343 |
| 101 | Ga0466704_454887 | 3300042643 | Bacteria | 7094 |
| 102 | Ga0466706_036578 | 3300042599 | Bacteria | 9473 |
| 103 | Ga0466722_224742 | 3300042609 | Unclassified | 2611 |
| 104 | Ga0466705_487384 | 3300042612 | Bacteria | 8059 |
| 105 | Ga0466711_006476 | 3300042615 | Bacteria | 4502 |
| 106 | Ga0466711_172506 | 3300042615 | Bacteria | 1072 |
| 107 | 2227255814 | 2225789004 | Bacteria | 7046 |
| 108 | JGI24702J35022_10183801 | 3300002462 | Bacteria | 1189 |
| 109 | Ga0068305_10039966 | 3300005083 | Bacteria | 22305 |
| 110 | Ga0104045_1019279 | 3300007085 | Bacteria | 6279 |
| 111 | Ga0466733_030455 | 3300042659 | Bacteria | 39544 |
| 112 | Ga0466729_313089 | 3300042621 | Bacteria | 2177 |
| 113 | Ga0466735_007852 | 3300042624 | Unclassified | 1016 |
| 114 | Ga0466703_191297 | 3300042636 | Bacteria | 4580 |
| 115 | Ga0466704_589446 | 3300042643 | Bacteria | 8974 |
| 116 | Ga0466706_225496 | 3300042599 | Bacteria | 28609 |
| 117 | Ga0466719_050874 | 3300042606 | Bacteria | 2830 |
| 118 | Ga0157631_138548 | 3300013007 | Bacteria | 1339 |
| 119 | Ga0466696_012754 | 3300042596 | Bacteria | 20010 |
| 120 | Ga0123355_10001507 | 3300009826 | Bacteria | 32473 |
| 121 | Ga0123356_12541714 | 3300010049 | Bacteria | 641 |
| 122 | JGI24698J34947_10140247 | 3300002449 | Bacteria | 1019 |
| 123 | JGI24696J40584_12945794 | 3300002834 | Bacteria | 1867 |
| 124 | Ga0466705_344682 | 3300042612 | Bacteria | 2900 |
| 125 | Ga0466733_086839 | 3300042659 | Bacteria | 20556 |
| 126 | Ga0466733_098252 | 3300042659 | Bacteria | 1307 |
| 127 | Ga0466735_070672 | 3300042624 | Bacteria | 1825 |
| 128 | Ga0466735_081200 | 3300042624 | Bacteria | 1530 |
| 129 | Ga0466735_120694 | 3300042624 | Bacteria | 1086 |
| 130 | Ga0466735_153070 | 3300042624 | Bacteria | 2197 |
| 131 | Ga0466735_184253 | 3300042624 | Unclassified | 1533 |
| 132 | Ga0466704_271187 | 3300042643 | Unclassified | 2566 |
| 133 | Ga0466709_302618 | 3300042648 | Bacteria | 4966 |
| 134 | Ga0466708_016107 | 3300042652 | Bacteria | 19240 |
| 135 | Ga0466706_070484 | 3300042599 | Bacteria | 5308 |
| 136 | Ga0466706_177909 | 3300042599 | Bacteria | 6542 |
| 137 | Ga0466706_189428 | 3300042599 | Bacteria | 3530 |
| 138 | Ga0466700_048019 | 3300042600 | Bacteria | 1219 |
| 139 | Ga0466713_098925 | 3300042602 | Bacteria | 3704 |
| 140 | Ga0466713_121237 | 3300042602 | Bacteria | 31656 |
| 141 | Ga0466714_025158 | 3300042603 | Bacteria | 61228 |
| 142 | Ga0466716_057070 | 3300042605 | Bacteria | 10501 |
| 143 | Ga0466719_019687 | 3300042606 | Bacteria | 7765 |
| 144 | Ga0466711_219386 | 3300042615 | Bacteria | 10258 |
| 145 | Ga0466715_265144 | 3300042616 | Bacteria | 16214 |
| 146 | Ga0466728_096178 | 3300042620 | Bacteria | 17451 |
| 147 | Ga0466729_102152 | 3300042621 | Bacteria | 10671 |
| 148 | JGI24698J34947_10334112 | 3300002449 | Bacteria | 535 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01883 | FeS_assembly_P | Iron-sulfur cluster assembly protein | 32 | 105 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.