Protein Family IF08743
Metagenome
Isolate
131
Members
52
Samples
120
Scaffolds
253.7
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_039712|Ga0466735_039712_8406_9329
- Length
- 307 aa
- Sequence
- LTKEDIVSTLFSAEVELPTQSSSLARASVVLMMLIGDISKTAVKHIDWRICFGKIEMKIVSWNVNGIRAIYKKNFTIWFKNENADIVCVQETKADETQFPKDIKEIDGYNFYCSSAEKKGYSGVAIWSKINPDFVSSSIENKIFDNEGRILRLDFKDFILFNIYFPNGGASQERLKHKMKFYDYLIKYLKQFENKTVLMCGDYNTAHFSIDLARSKENEKVSGFMPEEREKLDNLISSGFIDTFRYFNKEPGNYTWWDYKTAARSRNIGWRIDYFFMSQHSVKHLKSADIKKSVSGSDHCPISITVF
Sample Types
Isolate
8.4%
Metagenome
91.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.4%
Kalotermitidae
27.5%
Unclassified
23.5%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Hodotermitidae
2.0%
Passalidae
2.0%
Dytiscidae
2.0%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 18 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 19 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 31 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 38 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 49 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 50 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_062226 | 3300042612 | Bacteria | 3186 |
| 2 | Ga0466690_028352 | 3300042590 | Bacteria | 80670 |
| 3 | Ga0466694_154049 | 3300042594 | Bacteria | 3059 |
| 4 | Ga0466715_250662 | 3300042616 | Bacteria | 24658 |
| 5 | Ga0466726_090277 | 3300042619 | Bacteria | 2908 |
| 6 | Ga0466726_437684 | 3300042619 | Bacteria | 18840 |
| 7 | Ga0466728_003045 | 3300042620 | Bacteria | 90142 |
| 8 | Ga0466728_138454 | 3300042620 | Bacteria | 82446 |
| 9 | Ga0466707_127454 | 3300042601 | Bacteria | 2217 |
| 10 | Ga0466713_042171 | 3300042602 | Bacteria | 29656 |
| 11 | Ga0466722_016913 | 3300042609 | Bacteria | 12977 |
| 12 | Ga0466698_173849 | 3300042610 | Bacteria | 2954 |
| 13 | Ga0466735_094707 | 3300042624 | Bacteria | 17973 |
| 14 | Ga0466704_125943 | 3300042643 | Bacteria | 12098 |
| 15 | Ga0466709_082573 | 3300042648 | Bacteria | 19141 |
| 16 | Ga0123357_10086422 | 3300009784 | Bacteria | 4103 |
| 17 | Ga0466690_185760 | 3300042590 | Unclassified | 2599 |
| 18 | Ga0466705_499814 | 3300042612 | Unclassified | 3505 |
| 19 | Ga0466711_384441 | 3300042615 | Bacteria | 3085 |
| 20 | Ga0466723_123392 | 3300042618 | Bacteria | 27024 |
| 21 | Ga0466729_133904 | 3300042621 | Bacteria | 10657 |
| 22 | Ga0466706_094524 | 3300042599 | Bacteria | 6978 |
| 23 | Ga0466707_257889 | 3300042601 | Bacteria | 4618 |
| 24 | Ga0466720_007811 | 3300042607 | Bacteria | 1976 |
| 25 | Ga0466735_042633 | 3300042624 | Bacteria | 8408 |
| 26 | Ga0466735_053542 | 3300042624 | Bacteria | 20278 |
| 27 | Ga0466735_074220 | 3300042624 | Bacteria | 8208 |
| 28 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 29 | Ga0466704_020563 | 3300042643 | Bacteria | 1465 |
| 30 | Ga0466709_292660 | 3300042648 | Bacteria | 19708 |
| 31 | Ga0123356_10001429 | 3300010049 | Unclassified | 26418 |
| 32 | Ga0123356_10430464 | 3300010049 | Bacteria | 1464 |
| 33 | Ga0123353_10419877 | 3300010167 | Bacteria | 1982 |
| 34 | Ga0466711_115691 | 3300042615 | Bacteria | 24467 |
| 35 | Ga0466706_078972 | 3300042599 | Bacteria | 13090 |
| 36 | Ga0466706_156116 | 3300042599 | Bacteria | 30046 |
| 37 | Ga0466706_280526 | 3300042599 | Bacteria | 19466 |
| 38 | Ga0466716_267239 | 3300042605 | Bacteria | 10620 |
| 39 | Ga0466719_040767 | 3300042606 | Bacteria | 242892 |
| 40 | JGI24696J40584_12958036 | 3300002834 | Bacteria | 3843 |
| 41 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 42 | Ga0068305_10000968 | 3300005083 | Bacteria | 34979 |
| 43 | Ga0072941_1556960 | 3300005201 | Bacteria | 1238 |
| 44 | Ga0466735_150628 | 3300042624 | Unclassified | 30908 |
| 45 | Ga0466735_181430 | 3300042624 | Bacteria | 4642 |
| 46 | Ga0466704_017715 | 3300042643 | Unclassified | 114027 |
| 47 | Ga0466708_058201 | 3300042652 | Bacteria | 21023 |
| 48 | Ga0123355_10004968 | 3300009826 | Bacteria | 19362 |
| 49 | Ga0466693_395415 | 3300042592 | Bacteria | 2559 |
| 50 | Ga0466696_031130 | 3300042596 | Bacteria | 6796 |
| 51 | Ga0466701_007620 | 3300042598 | Bacteria | 1789 |
| 52 | Ga0466711_190502 | 3300042615 | Unclassified | 6598 |
| 53 | Ga0466711_250588 | 3300042615 | Bacteria | 6638 |
| 54 | Ga0466715_421227 | 3300042616 | Bacteria | 22521 |
| 55 | Ga0466726_406075 | 3300042619 | Unclassified | 2972 |
| 56 | Ga0466728_237086 | 3300042620 | Bacteria | 4094 |
| 57 | Ga0466706_258877 | 3300042599 | Bacteria | 4257 |
| 58 | Ga0466707_096029 | 3300042601 | Bacteria | 9378 |
| 59 | Ga0466719_102704 | 3300042606 | Bacteria | 110867 |
| 60 | IMNBL1DRAFT_c0011110 | 3300000062 | Unclassified | 4235 |
| 61 | JGI24698J34947_10006294 | 3300002449 | Bacteria | 6523 |
| 62 | Ga0068305_10000090 | 3300005083 | Bacteria | 152414 |
| 63 | Ga0466735_155572 | 3300042624 | Bacteria | 6504 |
| 64 | Ga0466703_284201 | 3300042636 | Bacteria | 2193 |
| 65 | Ga0466705_171019 | 3300042612 | Bacteria | 78873 |
| 66 | Ga0466690_130973 | 3300042590 | Bacteria | 51329 |
| 67 | Ga0466691_050213 | 3300042593 | Bacteria | 33690 |
| 68 | Ga0466696_267306 | 3300042596 | Bacteria | 8041 |
| 69 | Ga0466711_189352 | 3300042615 | Bacteria | 31754 |
| 70 | Ga0466711_363021 | 3300042615 | Bacteria | 4046 |
| 71 | Ga0466715_098538 | 3300042616 | Bacteria | 131452 |
| 72 | Ga0466723_257900 | 3300042618 | Bacteria | 18387 |
| 73 | Ga0466707_292421 | 3300042601 | Bacteria | 3143 |
| 74 | Ga0466713_016474 | 3300042602 | Bacteria | 5746 |
| 75 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 76 | JGI24702J35022_10019168 | 3300002462 | Bacteria | 3724 |
| 77 | Ga0466735_039712 | 3300042624 | Bacteria | 14788 |
| 78 | Ga0466735_058218 | 3300042624 | Bacteria | 21250 |
| 79 | Ga0466703_205020 | 3300042636 | Bacteria | 117626 |
| 80 | Ga0466705_163322 | 3300042612 | Bacteria | 155241 |
| 81 | Ga0123353_10051095 | 3300010167 | Bacteria | 6595 |
| 82 | Ga0466692_053244 | 3300042591 | Bacteria | 12730 |
| 83 | Ga0466696_327163 | 3300042596 | Bacteria | 3410 |
| 84 | Ga0466696_483744 | 3300042596 | Bacteria | 1157 |
| 85 | Ga0466723_054457 | 3300042618 | Bacteria | 34645 |
| 86 | Ga0466723_197211 | 3300042618 | Bacteria | 2263 |
| 87 | Ga0466713_079335 | 3300042602 | Bacteria | 100418 |
| 88 | Ga0466713_119990 | 3300042602 | Bacteria | 15178 |
| 89 | Ga0068305_10647953 | 3300005083 | Bacteria | 5498 |
| 90 | Ga0123355_10088143 | 3300009826 | Bacteria | 4930 |
| 91 | Ga0123353_10000218 | 3300010167 | Unclassified | 72534 |
| 92 | Ga0466690_198783 | 3300042590 | Bacteria | 25547 |
| 93 | Ga0466692_134733 | 3300042591 | Bacteria | 1254 |
| 94 | Ga0466691_034029 | 3300042593 | Unclassified | 1875 |
| 95 | Ga0466699_239938 | 3300042597 | Bacteria | 1117 |
| 96 | Ga0466699_335891 | 3300042597 | Bacteria | 2894 |
| 97 | Ga0466710_417049 | 3300042613 | Unclassified | 1049 |
| 98 | Ga0466711_117944 | 3300042615 | Bacteria | 215972 |
| 99 | Ga0466711_157498 | 3300042615 | Bacteria | 313285 |
| 100 | Ga0466723_289367 | 3300042618 | Bacteria | 62014 |
| 101 | Ga0466728_204525 | 3300042620 | Bacteria | 24884 |
| 102 | Ga0466707_057336 | 3300042601 | Bacteria | 145123 |
| 103 | Ga0466722_127529 | 3300042609 | Bacteria | 1960 |
| 104 | IMNBL1DRAFT_c0015898 | 3300000062 | Bacteria | 3242 |
| 105 | Ga0068305_10001548 | 3300005083 | Unclassified | 7056 |
| 106 | Ga0466735_045722 | 3300042624 | Bacteria | 5529 |
| 107 | Ga0466735_225814 | 3300042624 | Bacteria | 5319 |
| 108 | Ga0466704_079423 | 3300042643 | Bacteria | 74491 |
| 109 | Ga0466727_266831 | 3300042655 | Bacteria | 1068 |
| 110 | Ga0123353_10545338 | 3300010167 | Bacteria | 1674 |
| 111 | Ga0466690_145457 | 3300042590 | Unclassified | 20000 |
| 112 | Ga0466691_123502 | 3300042593 | Unclassified | 2040 |
| 113 | Ga0466705_388248 | 3300042612 | Bacteria | 16143 |
| 114 | Ga0466726_057733 | 3300042619 | Bacteria | 7920 |
| 115 | Ga0466728_213365 | 3300042620 | Bacteria | 4747 |
| 116 | Ga0466728_265513 | 3300042620 | Bacteria | 44529 |
| 117 | Ga0466714_164394 | 3300042603 | Bacteria | 6239 |
| 118 | Ga0466717_187036 | 3300042604 | Bacteria | 1144 |
| 119 | Ga0466719_005767 | 3300042606 | Bacteria | 2095 |
| 120 | Ga0466719_227278 | 3300042606 | Unclassified | 7301 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03372 | Exo_endo_phos | Endonuclease/Exonuclease/phosphatase family | 60 | 299 | 0.87 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03372 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.