Protein Family IF08738
Metagenome
Isolate
156
Members
69
Samples
131
Scaffolds
436.29
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_025336|Ga0466735_025336_1052_2329
- Length
- 416 aa
- Sequence
- VGKSTLFNRLTKSRRAIVNEQAGTTRDRQYGKSDWNGQEFSVIDTGGWVVNSTDVFEDEIKRQVQLAIEEADSLLFLVDVQNGITDFDEEVARILRQTKKPVFLVANKADTFDAQYLVAEFYKLGLGEPMPISAVNGLGTGDLLDKIVEIFPENERIAFVGRPNVGKSSIINAFLGEDRTIVTDIAGTTRDSIYVRFNKFGHDFYFVDTAGIRKKAKVNEDLEYYSVVRSIRAIENSDVCVLMLDATRGIEGQDLSIFSLIQKNRKGLVVCVNKWDLVESKENKDVKHFESAIRERLAPFVDFPIVFTSALNKQRILKVIELASAVYENKSRKVQTAKLNELFLPLIENYPPPALKGKYVKIKYVTQLPNTQVPTFVFFANLPQYIKEPYQRFLENKLRAEWEFTGTPVQLFFRNK
Sample Types
Isolate
16.0%
Metagenome
84.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.4%
Termitidae
23.2%
Kalotermitidae
18.8%
Unclassified
8.7%
Rhinotermitidae
5.8%
Termopsidae
5.8%
Passalidae
4.3%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 15 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 16 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 17 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 18 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 28 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 29 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 30 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 41 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 42 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 43 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 49 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 50 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 51 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 52 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 58 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 59 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 60 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 61 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 64 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 65 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 66 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 67 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 69 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_128376 | 3300042591 | Bacteria | 43265 |
| 2 | Ga0466691_015892 | 3300042593 | Bacteria | 9356 |
| 3 | Ga0466696_443206 | 3300042596 | Bacteria | 17122 |
| 4 | Ga0466711_016653 | 3300042615 | Bacteria | 16569 |
| 5 | Ga0466715_318605 | 3300042616 | Bacteria | 4562 |
| 6 | Ga0466718_033204 | 3300042617 | Bacteria | 1769 |
| 7 | Ga0466726_385768 | 3300042619 | Unclassified | 4367 |
| 8 | Ga0466735_025336 | 3300042624 | Bacteria | 2557 |
| 9 | Ga0466703_070580 | 3300042636 | Bacteria | 7354 |
| 10 | Ga0466703_246946 | 3300042636 | Bacteria | 14388 |
| 11 | Ga0466707_376420 | 3300042601 | Bacteria | 22118 |
| 12 | Ga0466713_119439 | 3300042602 | Bacteria | 22009 |
| 13 | Ga0466714_111320 | 3300042603 | Bacteria | 185233 |
| 14 | JGI24702J35022_10031564 | 3300002462 | Bacteria | 2838 |
| 15 | Ga0068305_10014153 | 3300005083 | Bacteria | 6017 |
| 16 | Ga0466705_342178 | 3300042612 | Bacteria | 42153 |
| 17 | Ga0466690_312691 | 3300042590 | Bacteria | 6428 |
| 18 | Ga0466691_028303 | 3300042593 | Bacteria | 6908 |
| 19 | Ga0466705_520056 | 3300042612 | Bacteria | 9333 |
| 20 | Ga0466710_044875 | 3300042613 | Bacteria | 3769 |
| 21 | Ga0466711_095269 | 3300042615 | Bacteria | 10475 |
| 22 | Ga0466715_098299 | 3300042616 | Bacteria | 65486 |
| 23 | Ga0466723_194429 | 3300042618 | Bacteria | 44464 |
| 24 | Ga0466729_287966 | 3300042621 | Unclassified | 2170 |
| 25 | Ga0466735_003895 | 3300042624 | Bacteria | 3803 |
| 26 | Ga0466735_185456 | 3300042624 | Bacteria | 4680 |
| 27 | Ga0466708_329889 | 3300042652 | Bacteria | 7408 |
| 28 | Ga0466727_086387 | 3300042655 | Bacteria | 3160 |
| 29 | Ga0466716_028167 | 3300042605 | Bacteria | 22705 |
| 30 | 2227561852 | 2225789004 | Bacteria | 2714 |
| 31 | JGI24699J35502_11134185 | 3300002509 | Bacteria | 47737 |
| 32 | Ga0466705_189441 | 3300042612 | Bacteria | 18281 |
| 33 | Ga0466733_103433 | 3300042659 | Bacteria | 33641 |
| 34 | Ga0466733_185397 | 3300042659 | Bacteria | 2265 |
| 35 | Ga0466656_080769 | 3300042550 | Bacteria | 19535 |
| 36 | Ga0466690_103895 | 3300042590 | Bacteria | 13537 |
| 37 | Ga0466690_158972 | 3300042590 | Bacteria | 37920 |
| 38 | Ga0466691_013990 | 3300042593 | Bacteria | 39551 |
| 39 | Ga0466710_278710 | 3300042613 | Bacteria | 16262 |
| 40 | Ga0466711_040380 | 3300042615 | Bacteria | 15149 |
| 41 | Ga0466715_411770 | 3300042616 | Bacteria | 6079 |
| 42 | Ga0466723_230208 | 3300042618 | Bacteria | 14199 |
| 43 | Ga0466703_118254 | 3300042636 | Bacteria | 6505 |
| 44 | Ga0466704_291813 | 3300042643 | Bacteria | 20152 |
| 45 | Ga0466727_137474 | 3300042655 | Bacteria | 5657 |
| 46 | Ga0466707_061953 | 3300042601 | Bacteria | 4450 |
| 47 | Ga0466707_158401 | 3300042601 | Bacteria | 7458 |
| 48 | Ga0466713_065595 | 3300042602 | Bacteria | 4349 |
| 49 | Ga0466713_110270 | 3300042602 | Bacteria | 25871 |
| 50 | Ga0466713_129716 | 3300042602 | Bacteria | 104954 |
| 51 | 2227111381 | 2225789004 | Bacteria | 9393 |
| 52 | 2227623524 | 2225789004 | Bacteria | 2171 |
| 53 | IMNBL1DRAFT_c0000203 | 3300000062 | Bacteria | 52380 |
| 54 | Ga0466733_138740 | 3300042659 | Bacteria | 4001 |
| 55 | Ga0466657_294566 | 3300042582 | Unclassified | 2943 |
| 56 | Ga0466657_337380 | 3300042582 | Bacteria | 20451 |
| 57 | Ga0466711_048662 | 3300042615 | Bacteria | 31707 |
| 58 | Ga0466715_486406 | 3300042616 | Bacteria | 9310 |
| 59 | Ga0466715_613764 | 3300042616 | Bacteria | 6180 |
| 60 | Ga0466728_302977 | 3300042620 | Bacteria | 25242 |
| 61 | Ga0466729_065241 | 3300042621 | Bacteria | 21132 |
| 62 | Ga0123353_10000278 | 3300010167 | Bacteria | 63177 |
| 63 | Ga0466703_036888 | 3300042636 | Bacteria | 17604 |
| 64 | Ga0466703_100821 | 3300042636 | Bacteria | 10628 |
| 65 | Ga0466701_069735 | 3300042598 | Bacteria | 6655 |
| 66 | Ga0466706_078960 | 3300042599 | Bacteria | 10873 |
| 67 | Ga0466713_008802 | 3300042602 | Bacteria | 69616 |
| 68 | Ga0466716_260561 | 3300042605 | Bacteria | 3203 |
| 69 | 2226999807 | 2225789003 | Bacteria | 6347 |
| 70 | Ga0466693_394919 | 3300042592 | Bacteria | 2187 |
| 71 | Ga0466715_385280 | 3300042616 | Bacteria | 24407 |
| 72 | Ga0466723_354543 | 3300042618 | Bacteria | 2220 |
| 73 | Ga0466726_180129 | 3300042619 | Bacteria | 17840 |
| 74 | Ga0466728_066997 | 3300042620 | Bacteria | 13179 |
| 75 | Ga0466709_215380 | 3300042648 | Bacteria | 33059 |
| 76 | Ga0466727_169553 | 3300042655 | Bacteria | 9366 |
| 77 | Ga0466700_174611 | 3300042600 | Bacteria | 29560 |
| 78 | Ga0466707_420035 | 3300042601 | Bacteria | 14009 |
| 79 | Ga0466716_356608 | 3300042605 | Bacteria | 21145 |
| 80 | IMNBL1DRAFT_c0002690 | 3300000062 | Bacteria | 12135 |
| 81 | JGI24702J35022_10001519 | 3300002462 | Bacteria | 14409 |
| 82 | Ga0466705_096235 | 3300042612 | Unclassified | 3714 |
| 83 | Ga0466690_049826 | 3300042590 | Bacteria | 9496 |
| 84 | Ga0466723_272360 | 3300042618 | Bacteria | 11837 |
| 85 | Ga0466729_005970 | 3300042621 | Bacteria | 14969 |
| 86 | Ga0466735_204079 | 3300042624 | Bacteria | 4713 |
| 87 | Ga0466704_192237 | 3300042643 | Bacteria | 19929 |
| 88 | Ga0466704_229795 | 3300042643 | Unclassified | 17391 |
| 89 | Ga0466704_415947 | 3300042643 | Bacteria | 4660 |
| 90 | Ga0466704_431598 | 3300042643 | Bacteria | 4479 |
| 91 | Ga0466704_512121 | 3300042643 | Unclassified | 6998 |
| 92 | Ga0466709_034964 | 3300042648 | Bacteria | 9366 |
| 93 | Ga0466727_124154 | 3300042655 | Bacteria | 1909 |
| 94 | Ga0466727_329273 | 3300042655 | Bacteria | 45796 |
| 95 | Ga0466706_089075 | 3300042599 | Bacteria | 35431 |
| 96 | Ga0466706_203302 | 3300042599 | Bacteria | 74431 |
| 97 | Ga0466713_003855 | 3300042602 | Bacteria | 6926 |
| 98 | Ga0466713_028370 | 3300042602 | Bacteria | 12991 |
| 99 | Ga0466716_221991 | 3300042605 | Bacteria | 25521 |
| 100 | IMNBL1DRAFT_c0006299 | 3300000062 | Bacteria | 6508 |
| 101 | Ga0068305_10134032 | 3300005083 | Unclassified | 2198 |
| 102 | Ga0466697_258576 | 3300042611 | Bacteria | 357278 |
| 103 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 104 | Ga0466691_179116 | 3300042593 | Bacteria | 10445 |
| 105 | Ga0466715_072353 | 3300042616 | Bacteria | 9199 |
| 106 | Ga0466715_085911 | 3300042616 | Bacteria | 54416 |
| 107 | Ga0466726_247770 | 3300042619 | Bacteria | 31730 |
| 108 | Ga0466728_110625 | 3300042620 | Bacteria | 42471 |
| 109 | Ga0466703_250498 | 3300042636 | Bacteria | 17409 |
| 110 | Ga0466704_180263 | 3300042643 | Bacteria | 6243 |
| 111 | Ga0466706_000283 | 3300042599 | Bacteria | 1400 |
| 112 | Ga0466706_004369 | 3300042599 | Bacteria | 14417 |
| 113 | Ga0466706_018876 | 3300042599 | Bacteria | 5472 |
| 114 | Ga0466706_193053 | 3300042599 | Bacteria | 20372 |
| 115 | Ga0466707_411122 | 3300042601 | Bacteria | 1492 |
| 116 | Ga0466713_149457 | 3300042602 | Bacteria | 12707 |
| 117 | Ga0466722_172548 | 3300042609 | Bacteria | 5057 |
| 118 | 2227400259 | 2225789004 | Bacteria | 5781 |
| 119 | JGI24702J35022_10004274 | 3300002462 | Bacteria | 8519 |
| 120 | JGI24702J35022_10010727 | 3300002462 | Bacteria | 5117 |
| 121 | Ga0466696_131706 | 3300042596 | Bacteria | 3051 |
| 122 | Ga0466696_248241 | 3300042596 | Bacteria | 3345 |
| 123 | Ga0466711_030287 | 3300042615 | Bacteria | 18879 |
| 124 | Ga0123357_10004008 | 3300009784 | Bacteria | 17120 |
| 125 | Ga0123356_10271725 | 3300010049 | Bacteria | 1785 |
| 126 | Ga0466703_061591 | 3300042636 | Bacteria | 26544 |
| 127 | Ga0466725_185075 | 3300042654 | Bacteria | 6984 |
| 128 | Ga0466727_065656 | 3300042655 | Bacteria | 6217 |
| 129 | Ga0466706_082212 | 3300042599 | Bacteria | 2130 |
| 130 | 2227552969 | 2225789004 | Bacteria | 2825 |
| 131 | Ga0068302_10148722 | 3300005071 | Bacteria | 3341 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14714 | KH_dom-like | KH-domain-like of EngA bacterial GTPase enzymes, C-terminal | 333 | 414 | 0.97 |
| PF01926 | MMR_HSR1 | 50S ribosome-binding GTPase | 156 | 274 | 0.9 |
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 20 | 152 | 0.83 |
| PF02421 | FeoB_N | Ferrous iron transport protein B | 156 | 319 | 0.81 |
| PF03193 | RsgA_GTPase | RsgA GTPase | 96 | 214 | 0.74 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01926 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.