Protein Family IF08735
Metagenome
Isolate
138
Members
57
Samples
134
Scaffolds
282.56
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_021426|Ga0466735_021426_20_964
- Length
- 314 aa
- Sequence
- MEVLYNGQHLPLAILSDWAKWSFIFTIENNMAKTNIITVQNIPISISVENDKDYICLTDMIKAKDGEFFISDWLRNKDTIEYVGTWESLYNPNFNYGEFTTIKNEAGSRAYRISVKDWVERTNAIGIIAKSGRYGGTYAYKDIAFNFGMWISPVFQLYVVREYQRLKEAESHPMLGEWNVKRVLSKVNYALHTDAVKDFVIPKIDVEQQKLYAYADEADLLNLALWGCTAKQWRDANPEHAKKGLNIRDTASINELVVLSNLESFNAELIKRDVDKSARYAYLREIAQSQLPRLDAIDAEKSFRAIKTTSKFSK
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.9%
Kalotermitidae
19.3%
Unclassified
10.5%
Termopsidae
7.0%
Formicidae
5.3%
Rhinotermitidae
3.5%
Hodotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
2
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820030127 | Unclassified Saccharibacteria Th196P4bin6 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 4 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 5 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 17 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 18 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 38 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 48 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 51 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 54 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 55 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 56 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_334119 | 3300042656 | Bacteria | 1246 |
| 2 | Ga0466711_141724 | 3300042615 | Bacteria | 1467 |
| 3 | Ga0466726_293580 | 3300042619 | Bacteria | 8989 |
| 4 | Ga0123356_10560303 | 3300010049 | Bacteria | 1304 |
| 5 | Ga0466707_276026 | 3300042601 | Bacteria | 23185 |
| 6 | Ga0466719_302513 | 3300042606 | Bacteria | 1585 |
| 7 | Ga0466693_310033 | 3300042592 | Bacteria | 1325 |
| 8 | Ga0466696_007811 | 3300042596 | Bacteria | 5936 |
| 9 | Ga0466696_344531 | 3300042596 | Bacteria | 7354 |
| 10 | JGI24702J35022_10012111 | 3300002462 | Bacteria | 4800 |
| 11 | JGI24696J40584_12943256 | 3300002834 | Bacteria | 1768 |
| 12 | Ga0068302_10126294 | 3300005071 | Bacteria | 2632 |
| 13 | Ga0466703_368253 | 3300042636 | Unclassified | 1470 |
| 14 | Ga0466697_119574 | 3300042611 | Bacteria | 1703 |
| 15 | Ga0466705_113106 | 3300042612 | Unclassified | 2448 |
| 16 | Ga0466705_174279 | 3300042612 | Bacteria | 11903 |
| 17 | Ga0466710_061039 | 3300042613 | Bacteria | 6940 |
| 18 | Ga0466715_509437 | 3300042616 | Bacteria | 4416 |
| 19 | Ga0466726_028244 | 3300042619 | Bacteria | 2115 |
| 20 | Ga0466728_238765 | 3300042620 | Bacteria | 7119 |
| 21 | Ga0466729_179661 | 3300042621 | Unclassified | 1101 |
| 22 | Ga0123356_10620275 | 3300010049 | Bacteria | 1247 |
| 23 | Ga0466706_121373 | 3300042599 | Bacteria | 45048 |
| 24 | Ga0466707_167286 | 3300042601 | Bacteria | 2079 |
| 25 | Ga0466707_354367 | 3300042601 | Bacteria | 52099 |
| 26 | Ga0466714_111443 | 3300042603 | Bacteria | 1372 |
| 27 | Ga0466717_098995 | 3300042604 | Bacteria | 1076 |
| 28 | Ga0466690_213399 | 3300042590 | Bacteria | 31259 |
| 29 | Ga0466693_136092 | 3300042592 | Bacteria | 1237 |
| 30 | IMNBL1DRAFT_c0025376 | 3300000062 | Bacteria | 2275 |
| 31 | JGI24702J35022_10000732 | 3300002462 | Bacteria | 20150 |
| 32 | JGI24703J35330_11552532 | 3300002501 | Bacteria | 1231 |
| 33 | Ga0466703_034643 | 3300042636 | Bacteria | 3703 |
| 34 | Ga0466703_128317 | 3300042636 | Bacteria | 1524 |
| 35 | Ga0466727_299259 | 3300042655 | Bacteria | 1490 |
| 36 | Ga0466705_208289 | 3300042612 | Unclassified | 3102 |
| 37 | Ga0466718_109050 | 3300042617 | Bacteria | 1142 |
| 38 | Ga0466726_348439 | 3300042619 | Bacteria | 2265 |
| 39 | Ga0123355_10074363 | 3300009826 | Bacteria | 5443 |
| 40 | Ga0123356_11089343 | 3300010049 | Bacteria | 967 |
| 41 | Ga0123354_10079053 | 3300010882 | Bacteria | 4669 |
| 42 | Ga0466707_212059 | 3300042601 | Bacteria | 1078 |
| 43 | Ga0466713_105233 | 3300042602 | Bacteria | 1374 |
| 44 | Ga0466721_109897 | 3300042608 | Bacteria | 3978 |
| 45 | Ga0466721_203075 | 3300042608 | Bacteria | 1829 |
| 46 | Ga0466690_178104 | 3300042590 | Bacteria | 3784 |
| 47 | Ga0466690_330083 | 3300042590 | Bacteria | 2458 |
| 48 | Ga0466693_136527 | 3300042592 | Bacteria | 1474 |
| 49 | Ga0466694_292106 | 3300042594 | Bacteria | 4074 |
| 50 | JGI24702J35022_10005261 | 3300002462 | Bacteria | 7589 |
| 51 | JGI24702J35022_10079246 | 3300002462 | Bacteria | 1778 |
| 52 | Ga0102736_1000110 | 3300007052 | Bacteria | 20756 |
| 53 | Ga0466735_021426 | 3300042624 | Bacteria | 1033 |
| 54 | Ga0466703_218984 | 3300042636 | Bacteria | 12016 |
| 55 | Ga0466704_002833 | 3300042643 | Unclassified | 16734 |
| 56 | Ga0466704_366177 | 3300042643 | Bacteria | 3339 |
| 57 | Ga0466727_150911 | 3300042655 | Bacteria | 3020 |
| 58 | Ga0466705_097319 | 3300042612 | Unclassified | 2332 |
| 59 | Ga0466732_162531 | 3300042656 | Bacteria | 2258 |
| 60 | Ga0466711_104172 | 3300042615 | Bacteria | 17590 |
| 61 | Ga0123355_10198385 | 3300009826 | Unclassified | 2938 |
| 62 | Ga0123356_10001597 | 3300010049 | Bacteria | 24904 |
| 63 | Ga0123356_10316094 | 3300010049 | Bacteria | 1673 |
| 64 | Ga0123354_10282660 | 3300010882 | Bacteria | 1608 |
| 65 | Ga0466706_028321 | 3300042599 | Bacteria | 102705 |
| 66 | JGI24705J35276_12196946 | 3300002504 | Bacteria | 1547 |
| 67 | JGI24705J35276_12231353 | 3300002504 | Bacteria | 3913 |
| 68 | Ga0466734_022402 | 3300042623 | Bacteria | 1170 |
| 69 | Ga0466703_336037 | 3300042636 | Bacteria | 3248 |
| 70 | Ga0466704_036660 | 3300042643 | Bacteria | 1393 |
| 71 | Ga0466705_322330 | 3300042612 | Bacteria | 1689 |
| 72 | Ga0466728_471946 | 3300042620 | Bacteria | 1287 |
| 73 | Ga0123353_10039096 | 3300010167 | Bacteria | 7463 |
| 74 | Ga0466700_297094 | 3300042600 | Bacteria | 1999 |
| 75 | Ga0466716_475767 | 3300042605 | Unclassified | 6575 |
| 76 | Ga0466721_394474 | 3300042608 | Bacteria | 1668 |
| 77 | Ga0466694_100673 | 3300042594 | Bacteria | 1181 |
| 78 | Ga0466695_188883 | 3300042595 | Bacteria | 2024 |
| 79 | Ga0466696_000125 | 3300042596 | Bacteria | 1477 |
| 80 | IMNBL1DRAFT_c0015709 | 3300000062 | Bacteria | 3275 |
| 81 | AustNasuHG_c1033047 | 3300000089 | Bacteria | 1418 |
| 82 | Ga0103268_1022304 | 3300007192 | Bacteria | 2351 |
| 83 | Ga0466731_265345 | 3300042622 | Archaea | 1621 |
| 84 | Ga0466734_143585 | 3300042623 | Bacteria | 1375 |
| 85 | Ga0466702_410068 | 3300042635 | Bacteria | 1328 |
| 86 | Ga0466704_172790 | 3300042643 | Bacteria | 3513 |
| 87 | Ga0466715_345020 | 3300042616 | Bacteria | 1696 |
| 88 | Ga0466718_101350 | 3300042617 | Bacteria | 3490 |
| 89 | Ga0466728_033060 | 3300042620 | Unclassified | 1671 |
| 90 | Ga0123356_10473494 | 3300010049 | Bacteria | 1404 |
| 91 | Ga0466707_390210 | 3300042601 | Bacteria | 6574 |
| 92 | Ga0466719_107591 | 3300042606 | Bacteria | 4861 |
| 93 | Ga0466698_416168 | 3300042610 | Bacteria | 1785 |
| 94 | Ga0466694_234943 | 3300042594 | Bacteria | 2029 |
| 95 | JGI24702J35022_10027810 | 3300002462 | Bacteria | 3041 |
| 96 | JGI24702J35022_10049452 | 3300002462 | Bacteria | 2239 |
| 97 | JGI24702J35022_10096124 | 3300002462 | Bacteria | 1617 |
| 98 | Ga0466705_013236 | 3300042612 | Unclassified | 1417 |
| 99 | Ga0466711_036704 | 3300042615 | Bacteria | 3492 |
| 100 | Ga0466718_149140 | 3300042617 | Bacteria | 1553 |
| 101 | Ga0466728_457716 | 3300042620 | Bacteria | 1263 |
| 102 | Ga0466729_043805 | 3300042621 | Bacteria | 1669 |
| 103 | Ga0123354_10057157 | 3300010882 | Bacteria | 5815 |
| 104 | Ga0466707_325467 | 3300042601 | Bacteria | 44614 |
| 105 | Ga0466716_288644 | 3300042605 | Bacteria | 3877 |
| 106 | Ga0466722_084309 | 3300042609 | Bacteria | 46740 |
| 107 | Ga0466691_123911 | 3300042593 | Bacteria | 10039 |
| 108 | Ga0466694_205763 | 3300042594 | Bacteria | 2000 |
| 109 | Ga0466699_007031 | 3300042597 | Bacteria | 3768 |
| 110 | AustNasuHG_c1039782 | 3300000089 | Bacteria | 1161 |
| 111 | JGI24695J34938_10068190 | 3300002450 | Bacteria | 1495 |
| 112 | JGI24702J35022_10087435 | 3300002462 | Bacteria | 1693 |
| 113 | JGI24702J35022_10153640 | 3300002462 | Archaea | 1293 |
| 114 | JGI24702J35022_10162951 | 3300002462 | Bacteria | 1257 |
| 115 | JGI24703J35330_11719053 | 3300002501 | Bacteria | 2342 |
| 116 | Ga0466729_205799 | 3300042621 | Bacteria | 1221 |
| 117 | Ga0466704_045724 | 3300042643 | Bacteria | 3901 |
| 118 | Ga0466724_50143 | 3300042649 | Bacteria | 2014 |
| 119 | Ga0466732_235754 | 3300042656 | Bacteria | 1060 |
| 120 | Ga0466711_125272 | 3300042615 | Unclassified | 7313 |
| 121 | Ga0466715_209500 | 3300042616 | Bacteria | 3485 |
| 122 | Ga0123353_11417402 | 3300010167 | Unclassified | 892 |
| 123 | Ga0466706_062321 | 3300042599 | Bacteria | 5846 |
| 124 | Ga0466707_390544 | 3300042601 | Bacteria | 3632 |
| 125 | Ga0466716_288663 | 3300042605 | Bacteria | 1069 |
| 126 | Ga0466716_417489 | 3300042605 | Bacteria | 27622 |
| 127 | IMNBL1DRAFT_c0039956 | 3300000062 | Bacteria | 1593 |
| 128 | JGI24698J34947_10101747 | 3300002449 | Bacteria | 1290 |
| 129 | JGI24696J40584_12953007 | 3300002834 | Bacteria | 2420 |
| 130 | Ga0103267_1000220 | 3300007190 | Bacteria | 22231 |
| 131 | Ga0123357_10003247 | 3300009784 | Bacteria | 18545 |
| 132 | Ga0466729_286638 | 3300042621 | Bacteria | 21139 |
| 133 | Ga0466731_105593 | 3300042622 | Bacteria | 1234 |
| 134 | Ga0466734_062517 | 3300042623 | Bacteria | 14270 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042621 | Ga0466729_179661 | Ga0466729_179661_276_995 | 239 |
| 2 | 3300000062 | IMNBL1DRAFT_c0015709 | IMNBL1DRAFT_00157095 | 248 |
| 3 | 3300042656 | Ga0466732_334119 | Ga0466732_334119_219_974 | 251 |
| 4 | 3300042636 | Ga0466703_368253 | Ga0466703_368253_698_1456 | 252 |
| 5 | 3300042612 | Ga0466705_013236 | Ga0466705_013236_27_800 | 257 |
| 6 | 3300042617 | Ga0466718_149140 | Ga0466718_149140_467_1276 | 258 |
| 7 | 3300042590 | Ga0466690_213399 | Ga0466690_213399_15042_15821 | 259 |
| 8 | 3300042612 | Ga0466705_113106 | Ga0466705_113106_253_1035 | 260 |
| 9 | 3300010049 | Ga0123356_10620275 | Ga0123356_106202752 | 262 |
| 10 | 3300042636 | Ga0466703_218984 | Ga0466703_218984_556_1350 | 264 |
| 11 | 3300042592 | Ga0466693_136092 | Ga0466693_136092_108_908 | 266 |
| 12 | 3300042601 | Ga0466707_167286 | Ga0466707_167286_788_1588 | 266 |
| 13 | 3300042622 | Ga0466731_265345 | Ga0466731_265345_800_1600 | 266 |
| 14 | 3300042623 | Ga0466734_143585 | Ga0466734_143585_121_921 | 266 |
| 15 | 3300042636 | Ga0466703_034643 | Ga0466703_034643_192_992 | 266 |
| 16 | 3300042649 | Ga0466724_50143 | Ga0466724_50143_986_1786 | 266 |
| 17 | 3300002462 | JGI24702J35022_10153640 | JGI24702J35022_101536401 | 267 |
| 18 | 3300002834 | JGI24696J40584_12953007 | JGI24696J40584_129530072 | 267 |
| 19 | 3300002462 | JGI24702J35022_10096124 | JGI24702J35022_100961242 | 269 |
| 20 | 3300042594 | Ga0466694_205763 | Ga0466694_205763_270_1079 | 269 |
| 21 | 3300042595 | Ga0466695_188883 | Ga0466695_188883_1082_1891 | 269 |
| 22 | 3300042604 | Ga0466717_098995 | Ga0466717_098995_162_971 | 269 |
| 23 | 3300002462 | JGI24702J35022_10049452 | JGI24702J35022_100494523 | 270 |
| 24 | 3300042590 | Ga0466690_330083 | Ga0466690_330083_1194_2009 | 271 |
| 25 | 3300042599 | Ga0466706_028321 | Ga0466706_028321_84837_85655 | 272 |
| 26 | 3300042600 | Ga0466700_297094 | Ga0466700_297094_581_1399 | 272 |
| 27 | 3300010882 | Ga0123354_10057157 | Ga0123354_100571573 | 273 |
| 28 | iso_pr_bacteria | 2820110010 | 2820110621 | 273 |
| 29 | 3300042610 | Ga0466698_416168 | Ga0466698_416168_836_1663 | 275 |
| 30 | 3300042611 | Ga0466697_119574 | Ga0466697_119574_680_1660 | 275 |
| 31 | 3300010167 | Ga0123353_11417402 | Ga0123353_114174021 | 276 |
| 32 | 3300010882 | Ga0123354_10079053 | Ga0123354_100790534 | 276 |
| 33 | 3300010049 | Ga0123356_11089343 | Ga0123356_110893432 | 277 |
| 34 | 3300042656 | Ga0466732_235754 | Ga0466732_235754_180_1040 | 277 |
| 35 | iso_pr_bacteria | 2778260941 | 2778359165 | 277 |
| 36 | 3300005071 | Ga0068302_10126294 | Ga0068302_101262943 | 280 |
| 37 | 3300042592 | Ga0466693_136527 | Ga0466693_136527_67_909 | 280 |
| 38 | 3300042599 | Ga0466706_121373 | Ga0466706_121373_27833_28675 | 280 |
| 39 | 3300042605 | Ga0466716_475767 | Ga0466716_475767_897_1739 | 280 |
| 40 | 3300042608 | Ga0466721_109897 | Ga0466721_109897_989_1831 | 280 |
| 41 | 3300042608 | Ga0466721_203075 | Ga0466721_203075_442_1284 | 280 |
| 42 | 3300042615 | Ga0466711_125272 | Ga0466711_125272_3442_4284 | 280 |
| 43 | 3300042620 | Ga0466728_033060 | Ga0466728_033060_538_1380 | 280 |
| 44 | iso_pr_bacteria | 2820558799 | 2820559791 | 280 |
| 45 | 3300000089 | AustNasuHG_c1039782 | AustNasuHG_10397822 | 281 |
| 46 | 3300010049 | Ga0123356_10001597 | Ga0123356_100015976 | 281 |
| 47 | 3300010882 | Ga0123354_10282660 | Ga0123354_102826601 | 281 |
| 48 | 3300042605 | Ga0466716_417489 | Ga0466716_417489_14123_14968 | 281 |
| 49 | 3300042612 | Ga0466705_174279 | Ga0466705_174279_4099_4944 | 281 |
| 50 | 3300010049 | Ga0123356_10560303 | Ga0123356_105603031 | 282 |
| 51 | 3300042612 | Ga0466705_322330 | Ga0466705_322330_88_936 | 282 |
| 52 | 3300042619 | Ga0466726_293580 | Ga0466726_293580_6992_7840 | 282 |
| 53 | 3300010049 | Ga0123356_10473494 | Ga0123356_104734942 | 283 |
| 54 | 3300042594 | Ga0466694_292106 | Ga0466694_292106_190_1041 | 283 |
| 55 | 3300042616 | Ga0466715_509437 | Ga0466715_509437_3404_4255 | 283 |
| 56 | 3300042620 | Ga0466728_238765 | Ga0466728_238765_467_1318 | 283 |
| 57 | 3300000062 | IMNBL1DRAFT_c0025376 | IMNBL1DRAFT_00253763 | 284 |
| 58 | 3300000089 | AustNasuHG_c1033047 | AustNasuHG_10330472 | 284 |
| 59 | 3300009826 | Ga0123355_10198385 | Ga0123355_101983854 | 284 |
| 60 | 3300042606 | Ga0466719_302513 | Ga0466719_302513_393_1247 | 284 |
| 61 | 3300042612 | Ga0466705_097319 | Ga0466705_097319_1406_2260 | 284 |
| 62 | 3300042620 | Ga0466728_457716 | Ga0466728_457716_275_1129 | 284 |
| 63 | 3300042643 | Ga0466704_002833 | Ga0466704_002833_14494_15348 | 284 |
| 64 | 3300042643 | Ga0466704_172790 | Ga0466704_172790_1895_2749 | 284 |
| 65 | 3300042643 | Ga0466704_366177 | Ga0466704_366177_468_1322 | 284 |
| 66 | iso_pr_bacteria | 2820030127 | 2820030915 | 284 |
| 67 | 3300002462 | JGI24702J35022_10012111 | JGI24702J35022_100121112 | 285 |
| 68 | 3300002501 | JGI24703J35330_11719053 | JGI24703J35330_117190532 | 285 |
| 69 | 3300002834 | JGI24696J40584_12943256 | JGI24696J40584_129432563 | 285 |
| 70 | 3300042601 | Ga0466707_354367 | Ga0466707_354367_2413_3270 | 285 |
| 71 | 3300042605 | Ga0466716_288663 | Ga0466716_288663_156_1013 | 285 |
| 72 | 3300042616 | Ga0466715_209500 | Ga0466715_209500_2013_2870 | 285 |
| 73 | 3300042621 | Ga0466729_205799 | Ga0466729_205799_59_916 | 285 |
| 74 | 3300042623 | Ga0466734_062517 | Ga0466734_062517_2631_3488 | 285 |
| 75 | 3300042636 | Ga0466703_336037 | Ga0466703_336037_1815_2672 | 285 |
| 76 | 3300002449 | JGI24698J34947_10101747 | JGI24698J34947_101017472 | 286 |
| 77 | 3300002462 | JGI24702J35022_10005261 | JGI24702J35022_100052612 | 286 |
| 78 | 3300002462 | JGI24702J35022_10027810 | JGI24702J35022_100278102 | 286 |
| 79 | 3300002501 | JGI24703J35330_11552532 | JGI24703J35330_115525321 | 286 |
| 80 | 3300002504 | JGI24705J35276_12231353 | JGI24705J35276_122313531 | 286 |
| 81 | 3300010167 | Ga0123353_10039096 | Ga0123353_100390963 | 286 |
| 82 | 3300042590 | Ga0466690_178104 | Ga0466690_178104_307_1167 | 286 |
| 83 | 3300042594 | Ga0466694_100673 | Ga0466694_100673_240_1100 | 286 |
| 84 | 3300042596 | Ga0466696_344531 | Ga0466696_344531_325_1185 | 286 |
| 85 | 3300042601 | Ga0466707_390210 | Ga0466707_390210_2683_3543 | 286 |
| 86 | 3300042615 | Ga0466711_141724 | Ga0466711_141724_167_1027 | 286 |
| 87 | 3300042619 | Ga0466726_348439 | Ga0466726_348439_624_1484 | 286 |
| 88 | 3300042621 | Ga0466729_043805 | Ga0466729_043805_739_1599 | 286 |
| 89 | 3300042623 | Ga0466734_022402 | Ga0466734_022402_100_960 | 286 |
| 90 | 3300042635 | Ga0466702_410068 | Ga0466702_410068_355_1215 | 286 |
| 91 | 3300042643 | Ga0466704_045724 | Ga0466704_045724_980_1840 | 286 |
| 92 | 3300042655 | Ga0466727_299259 | Ga0466727_299259_80_940 | 286 |
| 93 | 3300002450 | JGI24695J34938_10068190 | JGI24695J34938_100681901 | 287 |
| 94 | 3300002462 | JGI24702J35022_10000732 | JGI24702J35022_100007329 | 287 |
| 95 | 3300002462 | JGI24702J35022_10079246 | JGI24702J35022_100792461 | 287 |
| 96 | 3300002462 | JGI24702J35022_10087435 | JGI24702J35022_100874353 | 287 |
| 97 | 3300002462 | JGI24702J35022_10162951 | JGI24702J35022_101629512 | 287 |
| 98 | 3300009784 | Ga0123357_10003247 | Ga0123357_100032472 | 287 |
| 99 | 3300010049 | Ga0123356_10316094 | Ga0123356_103160941 | 287 |
| 100 | 3300042601 | Ga0466707_276026 | Ga0466707_276026_15105_15968 | 287 |
| 101 | 3300042601 | Ga0466707_390544 | Ga0466707_390544_2535_3398 | 287 |
| 102 | 3300042603 | Ga0466714_111443 | Ga0466714_111443_70_933 | 287 |
| 103 | 3300042619 | Ga0466726_028244 | Ga0466726_028244_456_1319 | 287 |
| 104 | 3300009826 | Ga0123355_10074363 | Ga0123355_100743635 | 288 |
| 105 | 3300042596 | Ga0466696_000125 | Ga0466696_000125_39_905 | 288 |
| 106 | 3300042601 | Ga0466707_212059 | Ga0466707_212059_152_1018 | 288 |
| 107 | 3300042609 | Ga0466722_084309 | Ga0466722_084309_45647_46513 | 288 |
| 108 | 3300042617 | Ga0466718_101350 | Ga0466718_101350_613_1479 | 288 |
| 109 | 3300002504 | JGI24705J35276_12196946 | JGI24705J35276_121969462 | 289 |
| 110 | 3300042606 | Ga0466719_107591 | Ga0466719_107591_3525_4394 | 289 |
| 111 | 3300042612 | Ga0466705_208289 | Ga0466705_208289_748_1617 | 289 |
| 112 | 3300042643 | Ga0466704_036660 | Ga0466704_036660_312_1181 | 289 |
| 113 | 3300042596 | Ga0466696_007811 | Ga0466696_007811_139_1011 | 290 |
| 114 | 3300042605 | Ga0466716_288644 | Ga0466716_288644_2101_2973 | 290 |
| 115 | 3300042617 | Ga0466718_109050 | Ga0466718_109050_160_1032 | 290 |
| 116 | 3300007192 | Ga0103268_1022304 | Ga0103268_10223044 | 291 |
| 117 | 3300042592 | Ga0466693_310033 | Ga0466693_310033_285_1160 | 291 |
| 118 | 3300042594 | Ga0466694_234943 | Ga0466694_234943_335_1210 | 291 |
| 119 | 3300042597 | Ga0466699_007031 | Ga0466699_007031_76_951 | 291 |
| 120 | 3300042620 | Ga0466728_471946 | Ga0466728_471946_369_1244 | 291 |
| 121 | 3300042602 | Ga0466713_105233 | Ga0466713_105233_379_1257 | 292 |
| 122 | 3300000062 | IMNBL1DRAFT_c0039956 | IMNBL1DRAFT_00399561 | 293 |
| 123 | 3300042615 | Ga0466711_036704 | Ga0466711_036704_1186_2067 | 293 |
| 124 | 3300042655 | Ga0466727_150911 | Ga0466727_150911_751_1632 | 293 |
| 125 | 3300007190 | Ga0103267_1000220 | Ga0103267_10002202 | 296 |
| 126 | 3300042616 | Ga0466715_345020 | Ga0466715_345020_586_1476 | 296 |
| 127 | 3300042621 | Ga0466729_286638 | Ga0466729_286638_830_1723 | 297 |
| 128 | 3300007052 | Ga0102736_1000110 | Ga0102736_100011014 | 298 |
| 129 | 3300042622 | Ga0466731_105593 | Ga0466731_105593_260_1159 | 299 |
| 130 | 3300042601 | Ga0466707_325467 | Ga0466707_325467_21_929 | 302 |
| 131 | 3300042636 | Ga0466703_128317 | Ga0466703_128317_437_1351 | 304 |
| 132 | 3300042599 | Ga0466706_062321 | Ga0466706_062321_2188_3105 | 305 |
| 133 | 3300042608 | Ga0466721_394474 | Ga0466721_394474_238_1158 | 306 |
| 134 | 3300042615 | Ga0466711_104172 | Ga0466711_104172_520_1440 | 306 |
| 135 | 3300042613 | Ga0466710_061039 | Ga0466710_061039_5665_6594 | 309 |
| 136 | 3300042656 | Ga0466732_162531 | Ga0466732_162531_184_1113 | 309 |
| 137 | 3300042593 | Ga0466691_123911 | Ga0466691_123911_256_1197 | 313 |
| 138 | 3300042624 | Ga0466735_021426 | Ga0466735_021426_20_964 | 314 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04383 | KilA-N | KilA-N domain | 46 | 167 | 0.87 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.55 | 0.57 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.