Protein Family IF08681

Metagenome Isolate
216 Members
95 Samples
172 Scaffolds
358.83 Avg Length

🧬 Representative Sequence

ID
3300042623|Ga0466734_102853|Ga0466734_102853_3339_4559
Length
406 aa
Sequence
MVHCKYSGLAGSAGILPVFILRTGGTPAFPWHSFYGAHPYLQGNKGARFIMRLKAGIVGGTGMVGQRFISLLENHPWFEVAAIAASXXXAGKSYAQAVEGRWKLASALPECVKNIVVQDASKVDEVASGLDLIFCAVDMKKDETRALEESYARAETPVVSNNSAHRLTPDVPMIIPEINPGHLEIIEYQKKRLGTKRGFIAVKPNCSIQSYVPALHALMEYRPVSVVACTYQAISGAGRTFKDWPEMVDNIIPYIGGEEEKSEQEPLRIWGGISDGAIVKAATPGITTQCIRVPVTDGHMAAVFVTFERKPSKEEILELWRSFRGRPQEMELPSAPKQFIRYFEEADRPQTKLDRDLENGMGVAVGRLREDSLHDYKFVSLSHNTVRGAAGGAVLIAELLKAEGYI

📊 Sample Types

Isolate 20.4%
Metagenome 79.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.7%
Termitidae 29.3%
Kalotermitidae 10.9%
Blattidae 9.8%
Termopsidae 4.3%
Passalidae 3.3%
Rhinotermitidae 3.3%
Armadillidiidae 2.2%
Scarabaeidae 1.1%
Hodotermitidae 1.1%
Apidae 1.1%

🌳 Taxonomy

Archaea 2
Bacteria 207
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
2 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
3 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
4 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
11 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
14 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
15 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
16 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
19 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
20 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
21 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
22 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
23 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
24 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
25 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
26 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
27 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
28 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
39 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
40 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
47 2593339125 Clostridium sp. 5 Isolate Termitidae
48 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
49 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
53 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
54 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
55 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
56 2590828840 Clostridium sp. 2 Isolate Termitidae
57 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
58 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
59 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
60 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
61 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
62 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
63 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
64 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
65 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
66 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
67 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
68 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
69 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
70 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
71 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
72 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
73 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
74 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
75 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
76 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
77 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
78 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
79 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
80 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
81 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
82 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
83 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
84 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
85 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
86 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
87 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
88 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
89 2820127165 Unclassified Proteobacteria Emb289P3bin90 Isolate Unclassified
90 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
91 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
92 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
93 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
94 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
95 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_420380 3300042612 Bacteria 591368
2 Ga0466718_138813 3300042617 Bacteria 2562
3 Ga0466731_213729 3300042622 Bacteria 1281
4 Ga0466702_190794 3300042635 Bacteria 2134
5 Ga0466703_073311 3300042636 Bacteria 30443
6 JGI24695J34938_10000697 3300002450 Bacteria 31714
7 Ga0123355_10016129 3300009826 Bacteria 11765
8 Ga0123355_10303175 3300009826 Bacteria 2175
9 Ga0123353_10136968 3300010167 Bacteria 3926
10 Ga0466706_044749 3300042599 Bacteria 7185
11 Ga0466706_064972 3300042599 Bacteria 11735
12 Ga0466706_223301 3300042599 Bacteria 40398
13 Ga0466700_244135 3300042600 Bacteria 13466
14 Ga0466707_262119 3300042601 Bacteria 21891
15 Ga0466714_053357 3300042603 Bacteria 2101
16 Ga0466719_456848 3300042606 Bacteria 85239
17 Ga0160467_102149 3300012829 Bacteria 4947
18 Ga0415639_004398 3300038395 Unclassified 7618
19 Ga0415639_023799 3300038395 Bacteria 35883
20 Ga0415639_157032 3300038395 Unclassified 1026
21 Ga0466696_014387 3300042596 Bacteria 23475
22 Ga0466696_379860 3300042596 Bacteria 2832
23 Ga0466715_042181 3300042616 Bacteria 63725
24 Ga0466715_411922 3300042616 Bacteria 42002
25 Ga0466729_053312 3300042621 Bacteria 29885
26 Ga0466729_254634 3300042621 Bacteria 3076
27 Ga0466702_370419 3300042635 Bacteria 8562
28 2227480187 2225789004 Bacteria 78142
29 Ga0072940_1291924 3300005200 Archaea 2963
30 Ga0123355_10032799 3300009826 Bacteria 8430
31 Ga0123356_10061082 3300010049 Bacteria 3518
32 Ga0123353_10096298 3300010167 Bacteria 4769
33 Ga0123353_10148469 3300010167 Bacteria 3746
34 Ga0123353_10176635 3300010167 Bacteria 3385
35 Ga0466706_032217 3300042599 Bacteria 49907
36 Ga0466706_099121 3300042599 Bacteria 26092
37 Ga0466706_155984 3300042599 Bacteria 4403
38 Ga0466707_041931 3300042601 Bacteria 3832
39 Ga0466714_167736 3300042603 Bacteria 6470
40 Ga0466716_369546 3300042605 Bacteria 2514
41 Ga0466693_046813 3300042592 Bacteria 1365
42 Ga0466733_207523 3300042659 Bacteria 3469
43 Ga0466718_100911 3300042617 Bacteria 3935
44 Ga0466702_129145 3300042635 Bacteria 18302
45 Ga0466702_407008 3300042635 Bacteria 1208
46 Ga0466704_103189 3300042643 Bacteria 58965
47 Ga0466727_343780 3300042655 Bacteria 7901
48 Ga0072941_1079606 3300005201 Bacteria 12395
49 Ga0123355_10011093 3300009826 Bacteria 13875
50 Ga0123355_10039386 3300009826 Bacteria 7689
51 Ga0123356_10015675 3300010049 Bacteria 7257
52 Ga0123356_10223111 3300010049 Bacteria 1942
53 Ga0123353_10007775 3300010167 Bacteria 14550
54 Ga0466706_006808 3300042599 Bacteria 35792
55 Ga0466714_078529 3300042603 Bacteria 17715
56 Ga0466719_453084 3300042606 Unclassified 4215
57 Ga0466722_265288 3300042609 Bacteria 4615
58 Ga0160444_102529 3300012841 Bacteria 2792
59 Ga0415639_091669 3300038395 Bacteria 2528
60 Ga0466692_060050 3300042591 Bacteria 1871
61 Ga0466718_057707 3300042617 Bacteria 6861
62 Ga0466726_488489 3300042619 Bacteria 5622
63 Ga0466702_032394 3300042635 Bacteria 34580
64 IMNBL1DRAFT_c0008029 3300000062 Bacteria 5437
65 JGI24705J35276_12195629 3300002504 Bacteria 1528
66 Ga0123355_10016048 3300009826 Bacteria 11789
67 Ga0123356_10000669 3300010049 Bacteria 37873
68 Ga0123353_10041968 3300010167 Bacteria 7233
69 Ga0123353_10186292 3300010167 Bacteria 3282
70 Ga0123353_10378625 3300010167 Bacteria 2118
71 Ga0160466_100856 3300012809 Bacteria 11295
72 Ga0466706_131558 3300042599 Bacteria 21014
73 Ga0466707_039554 3300042601 Bacteria 1380
74 Ga0466713_142802 3300042602 Bacteria 224732
75 Ga0466714_155065 3300042603 Bacteria 1737
76 Ga0466717_224990 3300042604 Bacteria 6431
77 Ga0415639_000672 3300038395 Bacteria 94504
78 Ga0415639_009182 3300038395 Bacteria 12523
79 Ga0415639_011546 3300038395 Bacteria 10404
80 Ga0466693_223915 3300042592 Bacteria 2606
81 Ga0466691_212677 3300042593 Bacteria 4994
82 Ga0466696_375600 3300042596 Bacteria 8621
83 Ga0466715_640524 3300042616 Bacteria 49586
84 Ga0466723_312829 3300042618 Bacteria 9292
85 Ga0466704_070315 3300042643 Bacteria 4076
86 2227080788 2225789004 Bacteria 142057
87 IMNBL1DRAFT_c0000847 3300000062 Bacteria 24007
88 Ga0068305_10038476 3300005083 Bacteria 58791
89 Ga0466706_028917 3300042599 Bacteria 2029
90 Ga0466706_166495 3300042599 Bacteria 1214
91 Ga0466700_313437 3300042600 Bacteria 1268
92 Ga0466707_212548 3300042601 Bacteria 93538
93 Ga0466713_141526 3300042602 Bacteria 43819
94 Ga0466714_016908 3300042603 Bacteria 1300
95 Ga0466714_062767 3300042603 Bacteria 1519
96 Ga0466719_533753 3300042606 Bacteria 2040
97 Ga0466722_161053 3300042609 Bacteria 58719
98 Ga0415639_004221 3300038395 Bacteria 18979
99 Ga0415639_086145 3300038395 Bacteria 2186
100 Ga0466705_139824 3300042612 Bacteria 61712
101 2227535729 2225789004 Bacteria 57601
102 AustNasuHG_c1000001 3300000089 Bacteria 78376
103 JGI24695J34938_10001564 3300002450 Bacteria 19283
104 JGI24702J35022_10085123 3300002462 Bacteria 1716
105 Ga0123355_10109445 3300009826 Archaea 4321
106 Ga0123355_10506051 3300009826 Bacteria 1487
107 Ga0123356_10000734 3300010049 Bacteria 36122
108 Ga0123356_10008749 3300010049 Bacteria 10036
109 Ga0123356_10511675 3300010049 Bacteria 1358
110 Ga0123353_10017538 3300010167 Bacteria 10531
111 Ga0123353_10062486 3300010167 Bacteria 5972
112 Ga0123353_10210527 3300010167 Bacteria 3050
113 Ga0123353_10296235 3300010167 Bacteria 2473
114 Ga0123353_10316613 3300010167 Unclassified 2370
115 Ga0466706_141178 3300042599 Bacteria 9196
116 Ga0466706_157485 3300042599 Bacteria 18529
117 Ga0466706_165948 3300042599 Bacteria 9149
118 Ga0466706_195039 3300042599 Bacteria 2363
119 Ga0466714_008983 3300042603 Bacteria 13749
120 Ga0466698_169800 3300042610 Bacteria 3375
121 Ga0466657_151483 3300042582 Bacteria 1501
122 Ga0466715_032121 3300042616 Bacteria 36016
123 Ga0466718_064128 3300042617 Bacteria 2693
124 Ga0466726_185141 3300042619 Bacteria 17114
125 Ga0466734_102853 3300042623 Bacteria 4728
126 Ga0466735_040365 3300042624 Bacteria 2396
127 Ga0466735_151470 3300042624 Bacteria 2480
128 Ga0068305_10005230 3300005083 Bacteria 6754
129 Ga0123355_10296968 3300009826 Bacteria 2208
130 Ga0123356_10001527 3300010049 Bacteria 25484
131 Ga0123356_10117996 3300010049 Bacteria 2575
132 Ga0123353_10237161 3300010167 Bacteria 2838
133 Ga0466701_035936 3300042598 Bacteria 4288
134 Ga0466706_084122 3300042599 Bacteria 1197
135 Ga0466706_253460 3300042599 Bacteria 2324
136 Ga0466707_076510 3300042601 Bacteria 1192
137 Ga0466714_058749 3300042603 Bacteria 1621
138 Ga0466714_102387 3300042603 Bacteria 1445
139 Ga0466719_100305 3300042606 Bacteria 13452
140 Ga0466722_255515 3300042609 Bacteria 20457
141 Ga0160452_100137 3300012834 Bacteria 89493
142 Ga0160452_100494 3300012834 Bacteria 25479
143 Ga0415639_019290 3300038395 Unclassified 2428
144 Ga0415639_086176 3300038395 Bacteria 4305
145 Ga0466694_355705 3300042594 Bacteria 3623
146 Ga0466701_014943 3300042598 Bacteria 55754
147 Ga0466705_057656 3300042612 Bacteria 9353
148 Ga0466723_270762 3300042618 Bacteria 21971
149 Ga0466704_248829 3300042643 Bacteria 10631
150 2227075517 2225789003 Unclassified 2298
151 IMNBL1DRAFT_c0002082 3300000062 Bacteria 14247
152 IMNBL1DRAFT_c0005081 3300000062 Bacteria 7651
153 JGI24695J34938_10002725 3300002450 Bacteria 13029
154 JGI24695J34938_10014698 3300002450 Bacteria 4045
155 JGI24702J35022_10009829 3300002462 Bacteria 5361
156 JGI24702J35022_10013054 3300002462 Bacteria 4608
157 Ga0068302_10267900 3300005071 Bacteria 2201
158 Ga0068305_10346874 3300005083 Bacteria 4195
159 Ga0123356_10005297 3300010049 Bacteria 13149
160 Ga0123356_10282849 3300010049 Bacteria 1755
161 Ga0123353_10260955 3300010167 Bacteria 2676
162 Ga0123353_10288348 3300010167 Bacteria 2515
163 Ga0466706_075785 3300042599 Bacteria 15657
164 Ga0466706_187792 3300042599 Unclassified 1252
165 Ga0466706_194038 3300042599 Bacteria 6197
166 Ga0466706_274074 3300042599 Bacteria 18421
167 Ga0466700_111662 3300042600 Bacteria 1655
168 Ga0466707_243945 3300042601 Bacteria 2546
169 Ga0466714_010591 3300042603 Bacteria 39899
170 Ga0466717_251337 3300042604 Bacteria 6714
171 Ga0466719_130485 3300042606 Bacteria 4722
172 Ga0466690_221393 3300042590 Bacteria 5390

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain 54 184 0.94
PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain 218 386 0.91

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.