Protein Family IF08644
Metagenome
Isolate
112
Members
53
Samples
105
Scaffolds
400.53
Avg Length
Representative Sequence
- ID
- 3300042623|Ga0466734_026245|Ga0466734_026245_281_1648
- Length
- 455 aa
- Sequence
- MRGRYIIAINSCLNFSAYLKSAKLEYFASFADLYYLCGMKGFVKRKEYLDKLFSYKDKDIIKVVTGLRRSGKSTLLEMFRKHLLENAVTSQQTQFYNFELPENYLNKSWETLYFEIKSKLQADEPNYIFLDEVQNIADFEKLVDGLYASENIDVYITGSNAYLLSGELATXXXGRYIEISILPFSFAEYLEFRGIDTSNKYLNYEALFYDYVNETSLPKGVELREAGFDKVYEYLEALYATIIEKDIRQRYKIYDKRAFGNVAKFVAANIGCSISPNSISKALKADNQSVHRETIEKFIEYLVESFVFYCVHRFDIKGKKQLATLEKYYLVDVGLLNVLVGRDRTADRGHILENVVYLELLRRGYKVWTGTLRNAEIDFAVKNRTGGIEYYQVSWELSTKETEEREFKSLEAVKDNYPKFLLTTESFPQSRSGIIHKNIFEWLLEKEYKNEKSIA
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
55.8%
Kalotermitidae
19.2%
Unclassified
15.4%
Rhinotermitidae
3.8%
Passalidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
1
Bacteria
105
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 14 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 15 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 16 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 20 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 21 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 22 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 23 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 24 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 50 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466693_252313 | 3300042592 | Bacteria | 1642 |
| 2 | Ga0466719_165281 | 3300042606 | Bacteria | 2110 |
| 3 | JGI24702J35022_10007709 | 3300002462 | Bacteria | 6147 |
| 4 | Ga0466732_316219 | 3300042656 | Bacteria | 1847 |
| 5 | Ga0466733_047324 | 3300042659 | Bacteria | 7221 |
| 6 | Ga0123356_10324097 | 3300010049 | Bacteria | 1655 |
| 7 | Ga0123353_10253843 | 3300010167 | Bacteria | 2721 |
| 8 | Ga0466704_054226 | 3300042643 | Unclassified | 2128 |
| 9 | Ga0466704_399641 | 3300042643 | Bacteria | 1801 |
| 10 | Ga0466704_434787 | 3300042643 | Bacteria | 16712 |
| 11 | Ga0466704_616614 | 3300042643 | Bacteria | 15267 |
| 12 | Ga0466708_093778 | 3300042652 | Bacteria | 24076 |
| 13 | Ga0466693_138501 | 3300042592 | Bacteria | 2525 |
| 14 | Ga0466706_090226 | 3300042599 | Bacteria | 2439 |
| 15 | Ga0466718_122344 | 3300042617 | Bacteria | 1509 |
| 16 | JGI24699J35502_11116988 | 3300002509 | Bacteria | 3002 |
| 17 | Ga0072940_1276694 | 3300005200 | Bacteria | 1737 |
| 18 | Ga0466733_038066 | 3300042659 | Bacteria | 1350 |
| 19 | Ga0123353_10000022 | 3300010167 | Bacteria | 176395 |
| 20 | Ga0466697_202385 | 3300042611 | Bacteria | 1689 |
| 21 | Ga0466697_279351 | 3300042611 | Bacteria | 4546 |
| 22 | Ga0466705_010075 | 3300042612 | Bacteria | 1767 |
| 23 | Ga0466729_225166 | 3300042621 | Bacteria | 1660 |
| 24 | Ga0466704_482329 | 3300042643 | Bacteria | 5463 |
| 25 | Ga0466701_075322 | 3300042598 | Bacteria | 2582 |
| 26 | Ga0466715_377367 | 3300042616 | Bacteria | 4273 |
| 27 | Ga0466729_195450 | 3300042621 | Bacteria | 7071 |
| 28 | 2227619929 | 2225789004 | Bacteria | 2195 |
| 29 | 2227669056 | 2225789004 | Bacteria | 10259 |
| 30 | AustNasuHG_c1020213 | 3300000089 | Bacteria | 2172 |
| 31 | JGI24702J35022_10050192 | 3300002462 | Bacteria | 2222 |
| 32 | JGI24696J40584_12957836 | 3300002834 | Bacteria | 3721 |
| 33 | Ga0072941_1011436 | 3300005201 | Bacteria | 13011 |
| 34 | Ga0466733_079772 | 3300042659 | Bacteria | 2987 |
| 35 | Ga0466733_132519 | 3300042659 | Bacteria | 3818 |
| 36 | Ga0466709_033004 | 3300042648 | Bacteria | 2589 |
| 37 | Ga0466706_227496 | 3300042599 | Bacteria | 47663 |
| 38 | Ga0466700_119367 | 3300042600 | Bacteria | 51339 |
| 39 | Ga0466698_054932 | 3300042610 | Bacteria | 1212 |
| 40 | Ga0466705_444439 | 3300042612 | Bacteria | 2208 |
| 41 | Ga0466711_285127 | 3300042615 | Bacteria | 62198 |
| 42 | Ga0466718_136502 | 3300042617 | Bacteria | 6514 |
| 43 | Ga0466733_016327 | 3300042659 | Bacteria | 7730 |
| 44 | Ga0466733_054861 | 3300042659 | Bacteria | 35457 |
| 45 | Ga0466733_087347 | 3300042659 | Bacteria | 23276 |
| 46 | Ga0123356_10478527 | 3300010049 | Bacteria | 1398 |
| 47 | Ga0123354_10204815 | 3300010882 | Bacteria | 2154 |
| 48 | Ga0123354_10344779 | 3300010882 | Bacteria | 1337 |
| 49 | Ga0466734_026245 | 3300042623 | Bacteria | 1961 |
| 50 | Ga0466724_29287 | 3300042649 | Bacteria | 1982 |
| 51 | Ga0466693_166641 | 3300042592 | Bacteria | 1484 |
| 52 | Ga0466693_319902 | 3300042592 | Bacteria | 3911 |
| 53 | Ga0466706_118922 | 3300042599 | Bacteria | 7434 |
| 54 | Ga0466706_162169 | 3300042599 | Bacteria | 5526 |
| 55 | Ga0466706_218002 | 3300042599 | Bacteria | 15756 |
| 56 | Ga0466714_119192 | 3300042603 | Bacteria | 7877 |
| 57 | Ga0466722_156677 | 3300042609 | Bacteria | 2511 |
| 58 | Ga0466697_022811 | 3300042611 | Bacteria | 2484 |
| 59 | Ga0466710_207165 | 3300042613 | Bacteria | 1465 |
| 60 | 2227472983 | 2225789004 | Bacteria | 4780 |
| 61 | JGI24695J34938_10075360 | 3300002450 | Unclassified | 1402 |
| 62 | JGI24702J35022_10025148 | 3300002462 | Bacteria | 3215 |
| 63 | Ga0466733_149088 | 3300042659 | Bacteria | 2583 |
| 64 | Ga0123353_10091596 | 3300010167 | Bacteria | 4897 |
| 65 | Ga0466705_060379 | 3300042612 | Bacteria | 5589 |
| 66 | Ga0466734_059571 | 3300042623 | Bacteria | 1743 |
| 67 | Ga0466702_099637 | 3300042635 | Bacteria | 3031 |
| 68 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 69 | Ga0466706_090233 | 3300042599 | Bacteria | 42004 |
| 70 | Ga0466728_017633 | 3300042620 | Bacteria | 4704 |
| 71 | 2227652704 | 2225789004 | Bacteria | 1993 |
| 72 | IMNBL1DRAFT_c0000483 | 3300000062 | Bacteria | 33213 |
| 73 | IMNBL1DRAFT_c0001462 | 3300000062 | Bacteria | 17663 |
| 74 | JGI24702J35022_10004733 | 3300002462 | Bacteria | 8052 |
| 75 | JGI24702J35022_10054810 | 3300002462 | Bacteria | 2127 |
| 76 | JGI24696J40584_12960717 | 3300002834 | Bacteria | 8169 |
| 77 | Ga0466732_059050 | 3300042656 | Bacteria | 11411 |
| 78 | Ga0466733_178607 | 3300042659 | Unclassified | 1705 |
| 79 | Ga0466725_454554 | 3300042654 | Bacteria | 2119 |
| 80 | Ga0466690_163900 | 3300042590 | Bacteria | 3127 |
| 81 | Ga0466694_057532 | 3300042594 | Bacteria | 1993 |
| 82 | Ga0466706_085585 | 3300042599 | Bacteria | 8991 |
| 83 | Ga0466707_306743 | 3300042601 | Unclassified | 2421 |
| 84 | Ga0466722_140307 | 3300042609 | Bacteria | 3513 |
| 85 | Ga0123357_10262112 | 3300009784 | Bacteria | 1825 |
| 86 | Ga0123355_10022159 | 3300009826 | Bacteria | 10181 |
| 87 | Ga0466657_139553 | 3300042582 | Bacteria | 4523 |
| 88 | Ga0466657_237423 | 3300042582 | Bacteria | 49323 |
| 89 | Ga0466694_090822 | 3300042594 | Bacteria | 3453 |
| 90 | Ga0466700_431844 | 3300042600 | Bacteria | 7417 |
| 91 | Ga0466707_241117 | 3300042601 | Archaea | 18381 |
| 92 | Ga0466714_003121 | 3300042603 | Bacteria | 1470 |
| 93 | Ga0466714_054123 | 3300042603 | Bacteria | 2458 |
| 94 | Ga0466719_122345 | 3300042606 | Bacteria | 1684 |
| 95 | Ga0466720_022510 | 3300042607 | Bacteria | 2345 |
| 96 | Ga0466697_000343 | 3300042611 | Unclassified | 2645 |
| 97 | Ga0466710_441585 | 3300042613 | Bacteria | 3266 |
| 98 | IMNBL1DRAFT_c0005300 | 3300000062 | Bacteria | 7424 |
| 99 | JGI24698J34947_10002865 | 3300002449 | Bacteria | 9360 |
| 100 | JGI24696J40584_12953456 | 3300002834 | Bacteria | 2487 |
| 101 | Ga0123356_10212293 | 3300010049 | Bacteria | 1985 |
| 102 | Ga0123354_10116826 | 3300010882 | Bacteria | 3476 |
| 103 | Ga0466705_275968 | 3300042612 | Bacteria | 2066 |
| 104 | Ga0466703_241977 | 3300042636 | Bacteria | 1812 |
| 105 | Ga0466704_033951 | 3300042643 | Unclassified | 3185 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.