Protein Family IF08636
Metagenome
Isolate
360
Members
272
Samples
177
Scaffolds
320.3
Avg Length
Representative Sequence
- ID
- 3300042623|Ga0466734_010092|Ga0466734_010092_4070_5179
- Length
- 369 aa
- Sequence
- MLDTLKHQVILYGSQGFSVLLIHLSPTRTLRKSYPSYATLPSSSLHEPSHTPMTAPKHCRLLILGSGPAGWTAAVYAARANLQPVVITGLQQGGQLMTTTEVDNWPGDTEGVMGPDLMARMQAHAERFETEVIFDQIHMTDLSKRPFKLLGDSGEYTCDALIIATGATAKYLGLPSEETFRGRGVSACATCDGFFYKDQDVAVVGGGNAAVEETLYLSNIARKVYLVHRRDTMRAEKILQNKLWARIEEGKIQPIWHHTVEEVLGNDTGVTGLRLKSVQDDSEQRIDVHGFFVAIGHRPNTGLFEGQLDMDNGYLKIRSGLAGGATQTSITGVFAAGDVADQHYRQAITSAGFGCMAALDAERFLDDNS
Sample Types
Isolate
50.8%
Metagenome
49.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
21.0%
Drosophilidae
19.1%
Unclassified
14.5%
Termitidae
7.6%
Formicidae
6.9%
Kalotermitidae
4.2%
Elmidae
3.8%
Culicidae
3.8%
Armadillidiidae
3.1%
Calliphoridae
2.3%
Ixodidae
1.9%
Curculionidae
1.5%
Argasidae
1.5%
Pteromalidae
1.1%
Termopsidae
1.1%
Aleyrodidae
0.8%
Rhinotermitidae
0.8%
Reduviidae
0.4%
Nymphalidae
0.4%
Glossinidae
0.4%
Noctuidae
0.4%
Anthocoridae
0.4%
Psyllidae
0.4%
Sarcophagidae
0.4%
Hydrophilidae
0.4%
Tenebrionidae
0.4%
Hodotermitidae
0.4%
Scarabaeidae
0.4%
Hippoboscidae
0.4%
Pediculidae
0.4%
Taxonomy
Archaea
0
Bacteria
336
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 2 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 3 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 4 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 5 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 6 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 7 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 8 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 9 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 10 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 11 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 12 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 13 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 14 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 15 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 16 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 17 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 18 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 19 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 20 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 21 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 24 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 25 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 26 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 27 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 28 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 29 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 30 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 31 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 32 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 33 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 34 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 35 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 36 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 37 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 38 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 39 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 40 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 41 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 42 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 43 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 44 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 45 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 46 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 47 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 48 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 49 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 50 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 53 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 54 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 55 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 56 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 57 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 58 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 59 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 60 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 61 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 62 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 63 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 64 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 65 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 66 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 67 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 68 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 69 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 70 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 71 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 72 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 73 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 74 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 75 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 76 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 77 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 78 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 79 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 80 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 81 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 82 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 83 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 84 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 85 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 86 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 87 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 88 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 90 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 91 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 92 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 93 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 94 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 95 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 96 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 97 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 98 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 99 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 100 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 101 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 102 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 103 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 104 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 105 | 2820092068 | Unclassified Proteobacteria Lab288P3bin38 | Isolate | Unclassified |
| 106 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 107 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 108 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 109 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 110 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 111 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 112 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 113 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 114 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 115 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 116 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 117 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 118 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 119 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 120 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 121 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 122 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 123 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 124 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 125 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 126 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 127 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 128 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 129 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 130 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 131 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 132 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 133 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 134 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 135 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 136 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 137 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 138 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 139 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 140 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 141 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 142 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 143 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 144 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 145 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 146 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 147 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 148 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 149 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 150 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 151 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 152 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 153 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 154 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 155 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 156 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 157 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 158 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 159 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 160 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 161 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 162 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 163 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 164 | 650716015 | Candidatus Midichloria mitochondrii IricVA | Isolate | Ixodidae |
| 165 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 166 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 167 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 168 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 169 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 170 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 171 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 172 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 173 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 174 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 175 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 176 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 177 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 178 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 179 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 180 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 181 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 182 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 183 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 184 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 185 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 186 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 187 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 188 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 189 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 190 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 191 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 192 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 193 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 194 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 195 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 196 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 197 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 198 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 199 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 200 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 201 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 202 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 203 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 204 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 205 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 206 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 207 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 208 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 209 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 210 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 211 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 212 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 213 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 214 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 215 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 216 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 217 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 218 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 219 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 220 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 221 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 222 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 223 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 224 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 225 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 226 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 227 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 228 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 229 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 230 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 231 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 232 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 233 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 234 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 235 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 236 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 237 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 238 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 239 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 240 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 241 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 242 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 243 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 244 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 245 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 246 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 247 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 248 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 249 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 250 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 251 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 252 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 253 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 254 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 255 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 256 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 257 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 258 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 259 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 260 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 261 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 262 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 263 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 264 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 265 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 266 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 267 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 268 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 269 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 270 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 271 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 272 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_106780 | 3300042611 | Bacteria | 7966 |
| 2 | Ga0562378_0225 | 3300056814 | Bacteria | 132269 |
| 3 | Ga0123353_10008289 | 3300010167 | Bacteria | 14175 |
| 4 | Ga0123354_10000024 | 3300010882 | Bacteria | 118691 |
| 5 | Ga0160471_100397 | 3300012812 | Bacteria | 12876 |
| 6 | Ga0466710_069708 | 3300042613 | Bacteria | 33462 |
| 7 | Ga0466715_279557 | 3300042616 | Bacteria | 43843 |
| 8 | Ga0466715_335483 | 3300042616 | Bacteria | 3347 |
| 9 | Ga0466734_086814 | 3300042623 | Bacteria | 2594 |
| 10 | Ga0466734_153938 | 3300042623 | Bacteria | 2991 |
| 11 | Ga0466724_09289 | 3300042649 | Bacteria | 15130 |
| 12 | Ga0466724_50289 | 3300042649 | Unclassified | 4820 |
| 13 | Ga0466725_302793 | 3300042654 | Bacteria | 49393 |
| 14 | Ga0160440_100024 | 3300012815 | Bacteria | 266548 |
| 15 | Ga0160433_100086 | 3300012846 | Bacteria | 96125 |
| 16 | Ga0160445_100004 | 3300012847 | Bacteria | 501773 |
| 17 | Ga0466657_248200 | 3300042582 | Bacteria | 22020 |
| 18 | Ga0466713_069234 | 3300042602 | Bacteria | 20178 |
| 19 | Ga0074278_148530 | 3300005721 | Bacteria | 48193 |
| 20 | Ga0102733_101760 | 3300006995 | Bacteria | 1350 |
| 21 | Ga0102734_1001443 | 3300007129 | Bacteria | 5897 |
| 22 | Ga0103260_1000049 | 3300007139 | Bacteria | 35225 |
| 23 | Ga0102738_1000020 | 3300007141 | Bacteria | 131526 |
| 24 | Ga0103264_1000280 | 3300007188 | Bacteria | 29350 |
| 25 | Ga0105004_1015959 | 3300007763 | Bacteria | 5975 |
| 26 | Ga0123353_10083901 | 3300010167 | Bacteria | 5128 |
| 27 | Ga0466710_196894 | 3300042613 | Bacteria | 17442 |
| 28 | Ga0466729_189129 | 3300042621 | Bacteria | 23371 |
| 29 | Ga0466734_010092 | 3300042623 | Bacteria | 5298 |
| 30 | Ga0466730_039761 | 3300042625 | Bacteria | 19345 |
| 31 | Ga0466724_14789 | 3300042649 | Unclassified | 3491 |
| 32 | Ga0160448_102173 | 3300012854 | Bacteria | 6141 |
| 33 | Ga0160436_1003517 | 3300012861 | Unclassified | 3833 |
| 34 | Ga0466657_019447 | 3300042582 | Bacteria | 2946 |
| 35 | Ga0466701_072609 | 3300042598 | Bacteria | 1884 |
| 36 | Ga0466706_120990 | 3300042599 | Bacteria | 2538 |
| 37 | Ga0466707_107812 | 3300042601 | Bacteria | 4981 |
| 38 | Ga0466717_051829 | 3300042604 | Bacteria | 4529 |
| 39 | JGI24695J34938_10065372 | 3300002450 | Bacteria | 1536 |
| 40 | JGI24702J35022_10000461 | 3300002462 | Bacteria | 24474 |
| 41 | Ga0068302_10037073 | 3300005071 | Bacteria | 12761 |
| 42 | Ga0102734_1000009 | 3300007129 | Bacteria | 88923 |
| 43 | Ga0103268_1000171 | 3300007192 | Bacteria | 21455 |
| 44 | Ga0103268_1000183 | 3300007192 | Bacteria | 20652 |
| 45 | Ga0466705_341476 | 3300042612 | Bacteria | 27817 |
| 46 | Ga0466726_317148 | 3300042619 | Bacteria | 7160 |
| 47 | Ga0466734_070210 | 3300042623 | Bacteria | 3616 |
| 48 | Ga0466730_082598 | 3300042625 | Unclassified | 5777 |
| 49 | Ga0466703_204881 | 3300042636 | Bacteria | 7342 |
| 50 | Ga0466709_263068 | 3300042648 | Bacteria | 21631 |
| 51 | Ga0466725_098332 | 3300042654 | Bacteria | 49688 |
| 52 | Ga0160455_100072 | 3300012837 | Bacteria | 177976 |
| 53 | Ga0160448_100280 | 3300012854 | Bacteria | 19814 |
| 54 | HBC_ctgsDRAFT_1019529 | 3300000333 | Unclassified | 1653 |
| 55 | JGI24703J35330_11748186 | 3300002501 | Bacteria | 11718 |
| 56 | Ga0063521_1001411 | 3300003973 | Unclassified | 6634 |
| 57 | Ga0063521_1001658 | 3300003973 | Unclassified | 5786 |
| 58 | Ga0072940_1007382 | 3300005200 | Bacteria | 21805 |
| 59 | Ga0074278_119202 | 3300005721 | Bacteria | 6104 |
| 60 | Ga0102735_1000430 | 3300007080 | Bacteria | 11484 |
| 61 | Ga0104041_1001594 | 3300007106 | Bacteria | 6100 |
| 62 | Ga0102740_1001428 | 3300007140 | Bacteria | 6064 |
| 63 | Ga0104019_1002586 | 3300007150 | Bacteria | 2198 |
| 64 | Ga0104019_1003308 | 3300007150 | Bacteria | 5427 |
| 65 | Ga0105004_1007198 | 3300007763 | Unclassified | 7748 |
| 66 | Ga0466705_291286 | 3300042612 | Bacteria | 34997 |
| 67 | Ga0123356_10008007 | 3300010049 | Bacteria | 10517 |
| 68 | Ga0123354_10001945 | 3300010882 | Bacteria | 26371 |
| 69 | Ga0466734_165747 | 3300042623 | Bacteria | 5260 |
| 70 | Ga0466703_161731 | 3300042636 | Bacteria | 15738 |
| 71 | Ga0466709_105421 | 3300042648 | Bacteria | 27532 |
| 72 | Ga0466727_036732 | 3300042655 | Bacteria | 37651 |
| 73 | Ga0160468_100941 | 3300012819 | Unclassified | 8859 |
| 74 | Ga0160467_102107 | 3300012829 | Bacteria | 5119 |
| 75 | Ga0160435_1000205 | 3300012857 | Unclassified | 28660 |
| 76 | Ga0466692_140070 | 3300042591 | Bacteria | 3703 |
| 77 | Ga0466692_173863 | 3300042591 | Bacteria | 18477 |
| 78 | Ga0466707_024269 | 3300042601 | Bacteria | 18210 |
| 79 | Ga0466713_030446 | 3300042602 | Bacteria | 8069 |
| 80 | Ga0074306_1117630 | 3300005309 | Unclassified | 2842 |
| 81 | Ga0074278_146133 | 3300005721 | Unclassified | 3350 |
| 82 | Ga0102736_1000016 | 3300007052 | Bacteria | 67121 |
| 83 | Ga0103265_1009124 | 3300007068 | Bacteria | 1303 |
| 84 | Ga0102737_1000003 | 3300007142 | Bacteria | 215134 |
| 85 | Ga0102737_1006502 | 3300007142 | Unclassified | 2220 |
| 86 | Ga0103267_1000385 | 3300007190 | Bacteria | 14701 |
| 87 | Ga0103267_1078270 | 3300007190 | Bacteria | 1699 |
| 88 | Ga0103268_1021204 | 3300007192 | Bacteria | 1472 |
| 89 | Ga0466697_214874 | 3300042611 | Bacteria | 2530 |
| 90 | Ga0466733_065275 | 3300042659 | Bacteria | 86472 |
| 91 | Ga0123353_10643744 | 3300010167 | Bacteria | 1502 |
| 92 | Ga0160470_100106 | 3300012813 | Bacteria | 96626 |
| 93 | Ga0466710_060540 | 3300042613 | Bacteria | 3685 |
| 94 | Ga0466715_095113 | 3300042616 | Bacteria | 11152 |
| 95 | Ga0160456_100061 | 3300012820 | Bacteria | 160654 |
| 96 | Ga0160458_100295 | 3300012832 | Bacteria | 30561 |
| 97 | Ga0160460_100120 | 3300012845 | Bacteria | 99802 |
| 98 | Ga0466657_257140 | 3300042582 | Bacteria | 7218 |
| 99 | JGI24702J35022_10122789 | 3300002462 | Bacteria | 1436 |
| 100 | JGI24705J35276_12234045 | 3300002504 | Bacteria | 5215 |
| 101 | CVPL010W_10021502 | 3300002931 | Bacteria | 5413 |
| 102 | Ga0063521_1000007 | 3300003973 | Bacteria | 219071 |
| 103 | Ga0103263_100084 | 3300007042 | Unclassified | 28991 |
| 104 | Ga0102734_1000671 | 3300007129 | Bacteria | 12168 |
| 105 | Ga0102737_1000919 | 3300007142 | Bacteria | 10759 |
| 106 | Ga0103267_1004116 | 3300007190 | Bacteria | 4928 |
| 107 | Ga0466710_085447 | 3300042613 | Bacteria | 1850 |
| 108 | Ga0466703_224874 | 3300042636 | Bacteria | 8218 |
| 109 | Ga0160431_100002 | 3300012828 | Bacteria | 521722 |
| 110 | Ga0160444_100126 | 3300012841 | Unclassified | 81991 |
| 111 | Ga0466657_307771 | 3300042582 | Bacteria | 4820 |
| 112 | Ga0466690_093763 | 3300042590 | Bacteria | 22028 |
| 113 | Ga0466701_044201 | 3300042598 | Unclassified | 7762 |
| 114 | Ga0466701_063916 | 3300042598 | Bacteria | 8630 |
| 115 | Ga0466713_103029 | 3300042602 | Bacteria | 264074 |
| 116 | CVPL010W_10013857 | 3300002931 | Unclassified | 10815 |
| 117 | Ga0074278_125783 | 3300005721 | Bacteria | 6360 |
| 118 | Ga0102740_1001028 | 3300007140 | Unclassified | 7361 |
| 119 | Ga0105553_1196480 | 3300007767 | Bacteria | 5868 |
| 120 | Ga0127645_129706 | 3300009461 | Bacteria | 6331 |
| 121 | Ga0123357_10002989 | 3300009784 | Bacteria | 19142 |
| 122 | Ga0466732_454717 | 3300042656 | Bacteria | 3005 |
| 123 | Ga0123354_10300383 | 3300010882 | Bacteria | 1520 |
| 124 | Ga0466730_052803 | 3300042625 | Bacteria | 2016 |
| 125 | Ga0466730_078606 | 3300042625 | Unclassified | 5498 |
| 126 | Ga0466704_061300 | 3300042643 | Bacteria | 59338 |
| 127 | Ga0466724_03961 | 3300042649 | Bacteria | 17245 |
| 128 | Ga0466724_51316 | 3300042649 | Unclassified | 3429 |
| 129 | Ga0466708_048966 | 3300042652 | Bacteria | 13460 |
| 130 | Ga0160430_100005 | 3300012852 | Bacteria | 393523 |
| 131 | Ga0160457_1000003 | 3300012858 | Bacteria | 1020748 |
| 132 | Ga0466657_301612 | 3300042582 | Bacteria | 34037 |
| 133 | Ga0466701_021875 | 3300042598 | Bacteria | 2257 |
| 134 | Ga0466719_477774 | 3300042606 | Bacteria | 3183 |
| 135 | DPOL_contig13278 | 2035918003 | Bacteria | 33529 |
| 136 | CVPL010W_10002909 | 3300002931 | Bacteria | 19904 |
| 137 | Ga0103266_1004666 | 3300007067 | Bacteria | 1826 |
| 138 | Ga0103261_1000060 | 3300007083 | Bacteria | 33259 |
| 139 | Ga0104042_1119484 | 3300007130 | Bacteria | 3681 |
| 140 | Ga0123357_10000011 | 3300009784 | Bacteria | 173575 |
| 141 | Ga0123357_10000467 | 3300009784 | Bacteria | 39326 |
| 142 | Ga0466727_352429 | 3300042655 | Bacteria | 14117 |
| 143 | Ga0123354_10128992 | 3300010882 | Bacteria | 3207 |
| 144 | Ga0466710_096128 | 3300042613 | Bacteria | 44826 |
| 145 | Ga0466710_150587 | 3300042613 | Bacteria | 2244 |
| 146 | Ga0466710_155352 | 3300042613 | Bacteria | 11411 |
| 147 | Ga0466710_244023 | 3300042613 | Bacteria | 9144 |
| 148 | Ga0466715_142274 | 3300042616 | Bacteria | 5597 |
| 149 | Ga0466723_013247 | 3300042618 | Bacteria | 13359 |
| 150 | Ga0466728_140959 | 3300042620 | Bacteria | 16315 |
| 151 | Ga0466730_047107 | 3300042625 | Unclassified | 10166 |
| 152 | Ga0466704_071661 | 3300042643 | Unclassified | 19081 |
| 153 | Ga0466724_51506 | 3300042649 | Bacteria | 34498 |
| 154 | Ga0466708_115383 | 3300042652 | Bacteria | 19512 |
| 155 | Ga0466725_012100 | 3300042654 | Bacteria | 6864 |
| 156 | Ga0466725_078597 | 3300042654 | Bacteria | 3300 |
| 157 | Ga0160434_100193 | 3300012850 | Bacteria | 29371 |
| 158 | Ga0466657_197744 | 3300042582 | Bacteria | 7037 |
| 159 | Ga0466690_220927 | 3300042590 | Bacteria | 22602 |
| 160 | Ga0466691_023386 | 3300042593 | Bacteria | 15216 |
| 161 | Ga0466701_009363 | 3300042598 | Bacteria | 432391 |
| 162 | Ga0466701_015671 | 3300042598 | Bacteria | 386482 |
| 163 | Ga0466717_013162 | 3300042604 | Unclassified | 4187 |
| 164 | Ga0466717_102427 | 3300042604 | Bacteria | 13013 |
| 165 | Ga0466717_162113 | 3300042604 | Bacteria | 3714 |
| 166 | FGTW_contig08189 | 2065487013 | Bacteria | 31890 |
| 167 | JGI24705J35276_12237990 | 3300002504 | Bacteria | 14757 |
| 168 | CVPL010L_1000099 | 3300002932 | Bacteria | 43218 |
| 169 | Ga0074311_1144256 | 3300005317 | Bacteria | 1446 |
| 170 | Ga0102735_1000145 | 3300007080 | Bacteria | 21702 |
| 171 | Ga0102739_1000002 | 3300007095 | Bacteria | 96752 |
| 172 | Ga0102739_1002729 | 3300007095 | Bacteria | 2666 |
| 173 | Ga0103260_1000177 | 3300007139 | Unclassified | 14126 |
| 174 | Ga0102740_1000362 | 3300007140 | Bacteria | 12791 |
| 175 | Ga0102738_1000208 | 3300007141 | Bacteria | 12520 |
| 176 | Ga0103267_1000005 | 3300007190 | Bacteria | 104420 |
| 177 | Ga0105005_1091231 | 3300007505 | Bacteria | 3910 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07992 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.