Protein Family IF08599
Metagenome
Isolate
410
Members
187
Samples
293
Scaffolds
320.27
Avg Length
Representative Sequence
- ID
- 3300042622|Ga0466731_175934|Ga0466731_175934_1159_2109
- Length
- 303 aa
- Sequence
- MKKNIFNQRVLVTGGAGFLGSHLCERLIKEQCDVICLDNFFTGNKKNIAHLFTHPYFELESIFNFACPASPYYYQHDPVQTIKTCVHGTINMLGLAKRTKAKILQASTSEIYGDPFEHPQKETYWGNVNPIGIRSCYDEGKRCAETLFFDYHRQHNLDIKVVRIFNTYGPRMHPNDGRVVSNFIMQALKNEDISIYGDGSQTRSFCYVDDLIDAVILAMNSDNFTGPVNIGNPNEFTIKELAENIIQLVDSKSKITYQKLPSDDPKQRRPDITLAKDKLNWEPKICLKDGLKETIKYFKQFLA
Sample Types
Isolate
28.5%
Metagenome
71.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
44.0%
Termitidae
17.6%
Unclassified
14.3%
Kalotermitidae
7.7%
Rhinotermitidae
2.2%
Termopsidae
2.2%
Culicidae
2.2%
Hydrophilidae
1.1%
Passalidae
1.1%
Formicidae
1.1%
Armadillidiidae
1.1%
Cambaridae
1.1%
Berytidae
1.1%
Porcellionidae
0.5%
Apidae
0.5%
Tenebrionidae
0.5%
Hodotermitidae
0.5%
Elmidae
0.5%
Cixiidae
0.5%
Taxonomy
Archaea
0
Bacteria
395
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 2 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 3 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 4 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 5 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 14 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 15 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 16 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 17 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 18 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 19 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 20 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 21 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 22 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 23 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 24 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 25 | 8073539042 | Candidatus Rhabdochlamydia porcellionis 15C | Isolate | Porcellionidae |
| 26 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 27 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 36 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 37 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 38 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 39 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 40 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 41 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 42 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 43 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 44 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 45 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 46 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 47 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 48 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 49 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 50 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 51 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 52 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 53 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 58 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 59 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 60 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 61 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 62 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 63 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 64 | 2820080004 | Unclassified Proteobacteria Lab288P4bin34 | Isolate | Unclassified |
| 65 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 68 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 69 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 70 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 71 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 72 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 73 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 74 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 75 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 76 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 77 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 78 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 79 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 80 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 81 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 82 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 83 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 84 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 85 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 86 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 87 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 88 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 89 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 90 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 91 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 92 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 93 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 94 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 95 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 96 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 97 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 98 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 99 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 100 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 101 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 102 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 103 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 104 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 105 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 106 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 107 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 108 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 109 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 110 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 111 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 112 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 113 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 114 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 115 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 116 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 117 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 118 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 119 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 120 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 121 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 122 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 123 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 124 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 125 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 126 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 127 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 128 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 129 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 130 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 131 | 2820137450 | Unclassified Proteobacteria Emb289P3bin120 | Isolate | Unclassified |
| 132 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 133 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 134 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 135 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 136 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 137 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 138 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 139 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 140 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 141 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 142 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 143 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 144 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 145 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 146 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 147 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 148 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 149 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 150 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 151 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 152 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 153 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 154 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 155 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 156 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 157 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 158 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 159 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 160 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 161 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 162 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 163 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 164 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 165 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 166 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 167 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 168 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 169 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 170 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 171 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 172 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 173 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 174 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 175 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 176 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 177 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 178 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 179 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 180 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 181 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 182 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 183 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 184 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 185 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 186 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 187 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_371546 | 3300042612 | Bacteria | 14589 |
| 2 | Ga0466733_110513 | 3300042659 | Bacteria | 3989 |
| 3 | Ga0466733_220811 | 3300042659 | Bacteria | 2707 |
| 4 | JGI24698J34947_10014334 | 3300002449 | Bacteria | 4317 |
| 5 | JGI24705J35276_12237945 | 3300002504 | Bacteria | 14351 |
| 6 | Ga0466735_023485 | 3300042624 | Bacteria | 3490 |
| 7 | Ga0466735_128279 | 3300042624 | Bacteria | 20246 |
| 8 | Ga0466703_416971 | 3300042636 | Bacteria | 2083 |
| 9 | Ga0466704_432423 | 3300042643 | Bacteria | 1280 |
| 10 | Ga0466708_098069 | 3300042652 | Bacteria | 14597 |
| 11 | Ga0466707_029287 | 3300042601 | Bacteria | 3987 |
| 12 | Ga0466707_303124 | 3300042601 | Bacteria | 2372 |
| 13 | Ga0466720_058406 | 3300042607 | Bacteria | 65856 |
| 14 | Ga0466720_198226 | 3300042607 | Bacteria | 2081 |
| 15 | Ga0466722_059827 | 3300042609 | Bacteria | 3778 |
| 16 | Ga0466722_149136 | 3300042609 | Bacteria | 80877 |
| 17 | Ga0466722_209385 | 3300042609 | Bacteria | 3657 |
| 18 | Ga0123357_10004067 | 3300009784 | Bacteria | 17036 |
| 19 | Ga0123355_10152587 | 3300009826 | Bacteria | 3505 |
| 20 | Ga0123355_10154231 | 3300009826 | Bacteria | 3480 |
| 21 | Ga0123356_10000472 | 3300010049 | Bacteria | 45079 |
| 22 | Ga0123356_10003237 | 3300010049 | Bacteria | 17112 |
| 23 | Ga0123353_10083868 | 3300010167 | Unclassified | 5129 |
| 24 | Ga0123353_10608122 | 3300010167 | Bacteria | 1560 |
| 25 | Ga0123354_10242667 | 3300010882 | Bacteria | 1849 |
| 26 | Ga0466711_066165 | 3300042615 | Bacteria | 24977 |
| 27 | Ga0466711_124600 | 3300042615 | Bacteria | 33924 |
| 28 | Ga0466711_400306 | 3300042615 | Bacteria | 1615 |
| 29 | Ga0466715_278143 | 3300042616 | Bacteria | 5454 |
| 30 | Ga0466715_387709 | 3300042616 | Bacteria | 7167 |
| 31 | Ga0466723_281326 | 3300042618 | Bacteria | 7769 |
| 32 | Ga0466723_331429 | 3300042618 | Unclassified | 10025 |
| 33 | Ga0466723_336853 | 3300042618 | Unclassified | 3931 |
| 34 | Ga0466726_373020 | 3300042619 | Bacteria | 1307 |
| 35 | Ga0160470_100179 | 3300012813 | Bacteria | 56481 |
| 36 | Ga0160448_100220 | 3300012854 | Bacteria | 23440 |
| 37 | Ga0264413_120289 | 3300024493 | Unclassified | 13454 |
| 38 | Ga0264413_157515 | 3300024493 | Bacteria | 1370 |
| 39 | Ga0415639_072826 | 3300038395 | Unclassified | 2250 |
| 40 | Ga0415639_087844 | 3300038395 | Bacteria | 2102 |
| 41 | Ga0466692_005842 | 3300042591 | Bacteria | 7347 |
| 42 | Ga0466692_083713 | 3300042591 | Bacteria | 23266 |
| 43 | Ga0466691_084803 | 3300042593 | Unclassified | 10004 |
| 44 | Ga0466695_166937 | 3300042595 | Bacteria | 1360 |
| 45 | Ga0466699_193978 | 3300042597 | Bacteria | 1893 |
| 46 | Ga0466705_312973 | 3300042612 | Bacteria | 4364 |
| 47 | Ga0530661_015970 | 3300056564 | Bacteria | 2108 |
| 48 | IMNBGM34_c000007 | 3300000036 | Bacteria | 57870 |
| 49 | JGI24695J34938_10038694 | 3300002450 | Bacteria | 2159 |
| 50 | Ga0072941_1001626 | 3300005201 | Bacteria | 73081 |
| 51 | Ga0072941_1013975 | 3300005201 | Bacteria | 17788 |
| 52 | Ga0102736_1000428 | 3300007052 | Bacteria | 17989 |
| 53 | Ga0466731_175934 | 3300042622 | Bacteria | 2590 |
| 54 | Ga0466703_105221 | 3300042636 | Bacteria | 14139 |
| 55 | Ga0466704_591099 | 3300042643 | Bacteria | 13482 |
| 56 | Ga0466709_293052 | 3300042648 | Bacteria | 1884 |
| 57 | Ga0466708_061843 | 3300042652 | Bacteria | 24472 |
| 58 | Ga0466706_208050 | 3300042599 | Bacteria | 1566 |
| 59 | Ga0466707_034890 | 3300042601 | Bacteria | 1121 |
| 60 | Ga0466707_192280 | 3300042601 | Bacteria | 3853 |
| 61 | Ga0466707_410848 | 3300042601 | Bacteria | 2226 |
| 62 | Ga0466714_153398 | 3300042603 | Bacteria | 2648 |
| 63 | Ga0466719_072099 | 3300042606 | Bacteria | 1898 |
| 64 | Ga0466719_451344 | 3300042606 | Bacteria | 3953 |
| 65 | Ga0466720_131156 | 3300042607 | Unclassified | 6698 |
| 66 | Ga0466721_349083 | 3300042608 | Bacteria | 17262 |
| 67 | Ga0123357_10252948 | 3300009784 | Bacteria | 1880 |
| 68 | Ga0123355_10116434 | 3300009826 | Bacteria | 4158 |
| 69 | Ga0123356_10617169 | 3300010049 | Bacteria | 1250 |
| 70 | Ga0123353_10001125 | 3300010167 | Bacteria | 32512 |
| 71 | Ga0466710_042183 | 3300042613 | Bacteria | 1497 |
| 72 | Ga0466712_244846 | 3300042614 | Bacteria | 3180 |
| 73 | Ga0466715_570665 | 3300042616 | Bacteria | 3981 |
| 74 | Ga0466726_275601 | 3300042619 | Bacteria | 3413 |
| 75 | Ga0466726_425357 | 3300042619 | Bacteria | 10250 |
| 76 | Ga0466690_040564 | 3300042590 | Bacteria | 2632 |
| 77 | Ga0466691_190395 | 3300042593 | Bacteria | 3188 |
| 78 | Ga0466696_244363 | 3300042596 | Bacteria | 1222 |
| 79 | Ga0466705_096550 | 3300042612 | Bacteria | 1602 |
| 80 | Ga0466705_173721 | 3300042612 | Bacteria | 12600 |
| 81 | Ga0466732_021190 | 3300042656 | Bacteria | 1966 |
| 82 | Ga0466732_080212 | 3300042656 | Bacteria | 4845 |
| 83 | Ga0466733_175804 | 3300042659 | Bacteria | 117218 |
| 84 | HBC_ctgsDRAFT_1000061 | 3300000333 | Bacteria | 27338 |
| 85 | JGI24698J34947_10037708 | 3300002449 | Bacteria | 2510 |
| 86 | JGI24695J34938_10002076 | 3300002450 | Bacteria | 15716 |
| 87 | JGI24705J35276_12221259 | 3300002504 | Bacteria | 2326 |
| 88 | JGI24705J35276_12237318 | 3300002504 | Bacteria | 10655 |
| 89 | Ga0466729_265156 | 3300042621 | Bacteria | 78626 |
| 90 | Ga0466730_007930 | 3300042625 | Bacteria | 1037 |
| 91 | Ga0466704_511798 | 3300042643 | Bacteria | 11083 |
| 92 | Ga0466709_107321 | 3300042648 | Bacteria | 19802 |
| 93 | Ga0466709_149395 | 3300042648 | Bacteria | 23801 |
| 94 | Ga0466709_253117 | 3300042648 | Bacteria | 7915 |
| 95 | Ga0466708_062913 | 3300042652 | Bacteria | 58224 |
| 96 | Ga0466708_216611 | 3300042652 | Bacteria | 1237 |
| 97 | Ga0466727_271446 | 3300042655 | Bacteria | 1947 |
| 98 | Ga0466700_254672 | 3300042600 | Bacteria | 254759 |
| 99 | Ga0466713_005312 | 3300042602 | Bacteria | 7061 |
| 100 | Ga0466713_104475 | 3300042602 | Bacteria | 22302 |
| 101 | Ga0466722_262572 | 3300042609 | Bacteria | 19581 |
| 102 | Ga0123355_10052775 | 3300009826 | Unclassified | 6594 |
| 103 | Ga0123356_10267793 | 3300010049 | Bacteria | 1796 |
| 104 | Ga0123354_10314267 | 3300010882 | Unclassified | 1457 |
| 105 | Ga0466712_190571 | 3300042614 | Bacteria | 5771 |
| 106 | Ga0466711_063723 | 3300042615 | Bacteria | 3464 |
| 107 | Ga0466715_157238 | 3300042616 | Bacteria | 4104 |
| 108 | Ga0466726_119195 | 3300042619 | Bacteria | 1488 |
| 109 | Ga0466728_231821 | 3300042620 | Bacteria | 4389 |
| 110 | Ga0466729_098348 | 3300042621 | Bacteria | 1139 |
| 111 | Ga0466729_163133 | 3300042621 | Bacteria | 7033 |
| 112 | Ga0415639_005663 | 3300038395 | Unclassified | 6044 |
| 113 | Ga0466699_148287 | 3300042597 | Bacteria | 3687 |
| 114 | Ga0466705_070380 | 3300042612 | Bacteria | 9633 |
| 115 | AustNasuHG_c1000133 | 3300000089 | Unclassified | 23169 |
| 116 | JGI24695J34938_10000431 | 3300002450 | Bacteria | 40398 |
| 117 | JGI24695J34938_10006806 | 3300002450 | Bacteria | 6786 |
| 118 | JGI24705J35276_12222415 | 3300002504 | Bacteria | 2419 |
| 119 | JGI24696J40584_12960539 | 3300002834 | Bacteria | 7523 |
| 120 | Ga0072941_1003366 | 3300005201 | Bacteria | 31222 |
| 121 | Ga0466731_188421 | 3300042622 | Bacteria | 30299 |
| 122 | Ga0466704_285066 | 3300042643 | Bacteria | 3202 |
| 123 | Ga0466704_447188 | 3300042643 | Bacteria | 17581 |
| 124 | Ga0466708_153036 | 3300042652 | Bacteria | 3269 |
| 125 | Ga0466708_183984 | 3300042652 | Bacteria | 148491 |
| 126 | Ga0466707_018908 | 3300042601 | Bacteria | 3858 |
| 127 | Ga0466707_021893 | 3300042601 | Bacteria | 9501 |
| 128 | Ga0466716_480789 | 3300042605 | Bacteria | 20702 |
| 129 | Ga0466721_383021 | 3300042608 | Bacteria | 14602 |
| 130 | Ga0466722_071693 | 3300042609 | Bacteria | 20421 |
| 131 | Ga0466722_124768 | 3300042609 | Bacteria | 11230 |
| 132 | Ga0466722_158667 | 3300042609 | Bacteria | 39485 |
| 133 | Ga0466698_174983 | 3300042610 | Bacteria | 2171 |
| 134 | Ga0123355_10091032 | 3300009826 | Bacteria | 4836 |
| 135 | Ga0123356_10019344 | 3300010049 | Bacteria | 6454 |
| 136 | Ga0123356_10024683 | 3300010049 | Bacteria | 5655 |
| 137 | Ga0123353_10275001 | 3300010167 | Bacteria | 2591 |
| 138 | Ga0123353_11018936 | 3300010167 | Bacteria | 1110 |
| 139 | Ga0466710_118825 | 3300042613 | Bacteria | 2039 |
| 140 | Ga0466711_361122 | 3300042615 | Bacteria | 23649 |
| 141 | Ga0466715_053407 | 3300042616 | Bacteria | 7550 |
| 142 | Ga0466715_176789 | 3300042616 | Bacteria | 8953 |
| 143 | Ga0466715_344885 | 3300042616 | Bacteria | 2183 |
| 144 | Ga0466723_173209 | 3300042618 | Bacteria | 3222 |
| 145 | Ga0466726_165860 | 3300042619 | Bacteria | 18373 |
| 146 | Ga0466726_239503 | 3300042619 | Bacteria | 43269 |
| 147 | Ga0160472_100296 | 3300012839 | Bacteria | 51482 |
| 148 | Ga0466696_301841 | 3300042596 | Bacteria | 5684 |
| 149 | Ga0466705_257964 | 3300042612 | Bacteria | 12194 |
| 150 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 151 | IMNBL1DRAFT_c0010807 | 3300000062 | Bacteria | 4326 |
| 152 | JGI24698J34947_10004778 | 3300002449 | Bacteria | 7404 |
| 153 | JGI24698J34947_10005177 | 3300002449 | Bacteria | 7152 |
| 154 | JGI24698J34947_10022137 | 3300002449 | Unclassified | 3411 |
| 155 | JGI24695J34938_10003029 | 3300002450 | Bacteria | 12061 |
| 156 | Ga0466735_067745 | 3300042624 | Bacteria | 3998 |
| 157 | Ga0466702_266238 | 3300042635 | Bacteria | 2664 |
| 158 | Ga0466703_327345 | 3300042636 | Bacteria | 24262 |
| 159 | Ga0466703_359176 | 3300042636 | Bacteria | 1301 |
| 160 | Ga0466703_420138 | 3300042636 | Bacteria | 1594 |
| 161 | Ga0466703_427618 | 3300042636 | Bacteria | 2184 |
| 162 | Ga0466704_142428 | 3300042643 | Bacteria | 3479 |
| 163 | Ga0466704_244902 | 3300042643 | Bacteria | 52327 |
| 164 | Ga0466709_168357 | 3300042648 | Bacteria | 5413 |
| 165 | Ga0466708_295997 | 3300042652 | Bacteria | 4584 |
| 166 | Ga0466727_223669 | 3300042655 | Bacteria | 1690 |
| 167 | Ga0466713_105834 | 3300042602 | Bacteria | 10355 |
| 168 | Ga0466720_059776 | 3300042607 | Unclassified | 2051 |
| 169 | Ga0466722_099575 | 3300042609 | Bacteria | 7990 |
| 170 | Ga0466722_101213 | 3300042609 | Bacteria | 4581 |
| 171 | Ga0466722_146747 | 3300042609 | Bacteria | 23381 |
| 172 | Ga0123355_10564519 | 3300009826 | Bacteria | 1369 |
| 173 | Ga0123356_10013539 | 3300010049 | Bacteria | 7867 |
| 174 | Ga0123356_10112156 | 3300010049 | Bacteria | 2636 |
| 175 | Ga0466711_142820 | 3300042615 | Bacteria | 35097 |
| 176 | Ga0466711_170527 | 3300042615 | Bacteria | 7921 |
| 177 | Ga0466711_344800 | 3300042615 | Bacteria | 3383 |
| 178 | Ga0466715_155217 | 3300042616 | Bacteria | 3783 |
| 179 | Ga0466715_169632 | 3300042616 | Bacteria | 1178 |
| 180 | Ga0466715_190552 | 3300042616 | Bacteria | 1478 |
| 181 | Ga0466723_115281 | 3300042618 | Bacteria | 1268 |
| 182 | Ga0466723_373860 | 3300042618 | Bacteria | 6278 |
| 183 | Ga0466726_147383 | 3300042619 | Bacteria | 2447 |
| 184 | Ga0466726_229267 | 3300042619 | Bacteria | 12683 |
| 185 | Ga0466728_184197 | 3300042620 | Bacteria | 1503 |
| 186 | Ga0466729_063717 | 3300042621 | Bacteria | 2477 |
| 187 | Ga0160432_100166 | 3300012818 | Bacteria | 60433 |
| 188 | Ga0160436_1000473 | 3300012861 | Bacteria | 15453 |
| 189 | Ga0264413_125051 | 3300024493 | Unclassified | 3554 |
| 190 | Ga0264413_144475 | 3300024493 | Bacteria | 6139 |
| 191 | Ga0466691_158464 | 3300042593 | Bacteria | 2412 |
| 192 | Ga0466705_006758 | 3300042612 | Bacteria | 2416 |
| 193 | Ga0466705_059463 | 3300042612 | Bacteria | 40059 |
| 194 | Ga0466705_122021 | 3300042612 | Bacteria | 2163 |
| 195 | Ga0466705_191582 | 3300042612 | Bacteria | 7549 |
| 196 | Ga0466732_101152 | 3300042656 | Bacteria | 1207 |
| 197 | Ga0466733_216639 | 3300042659 | Bacteria | 1624 |
| 198 | Ga0530661_026316 | 3300056564 | Bacteria | 1668 |
| 199 | Ga0068305_10032545 | 3300005083 | Bacteria | 3913 |
| 200 | Ga0123357_10002968 | 3300009784 | Bacteria | 19183 |
| 201 | Ga0466731_366031 | 3300042622 | Bacteria | 2023 |
| 202 | Ga0466735_048729 | 3300042624 | Bacteria | 4967 |
| 203 | Ga0466703_083020 | 3300042636 | Bacteria | 6226 |
| 204 | Ga0466703_191064 | 3300042636 | Bacteria | 17330 |
| 205 | Ga0466703_232888 | 3300042636 | Bacteria | 8603 |
| 206 | Ga0466704_545871 | 3300042643 | Bacteria | 30505 |
| 207 | Ga0466707_027283 | 3300042601 | Bacteria | 1985 |
| 208 | Ga0466713_007852 | 3300042602 | Bacteria | 1867 |
| 209 | Ga0466719_187773 | 3300042606 | Bacteria | 5685 |
| 210 | Ga0123357_10004734 | 3300009784 | Bacteria | 16094 |
| 211 | Ga0123355_10027355 | 3300009826 | Bacteria | 9212 |
| 212 | Ga0123355_10039905 | 3300009826 | Bacteria | 7642 |
| 213 | Ga0123356_10194326 | 3300010049 | Bacteria | 2063 |
| 214 | Ga0123356_10313071 | 3300010049 | Bacteria | 1680 |
| 215 | Ga0466711_182182 | 3300042615 | Bacteria | 4548 |
| 216 | Ga0466711_447405 | 3300042615 | Bacteria | 11641 |
| 217 | Ga0466715_109622 | 3300042616 | Bacteria | 3926 |
| 218 | Ga0466718_016575 | 3300042617 | Bacteria | 5183 |
| 219 | Ga0466718_030392 | 3300042617 | Bacteria | 49137 |
| 220 | Ga0466723_014160 | 3300042618 | Bacteria | 2804 |
| 221 | Ga0466723_148649 | 3300042618 | Bacteria | 2243 |
| 222 | Ga0466726_247717 | 3300042619 | Bacteria | 4422 |
| 223 | Ga0466726_328523 | 3300042619 | Bacteria | 1293 |
| 224 | Ga0466690_072851 | 3300042590 | Bacteria | 8049 |
| 225 | Ga0466692_162099 | 3300042591 | Bacteria | 2809 |
| 226 | Ga0466691_122132 | 3300042593 | Bacteria | 3532 |
| 227 | Ga0466694_089414 | 3300042594 | Bacteria | 1446 |
| 228 | Ga0466696_153434 | 3300042596 | Bacteria | 9020 |
| 229 | Ga0466696_277251 | 3300042596 | Bacteria | 1440 |
| 230 | Ga0466696_298520 | 3300042596 | Bacteria | 7147 |
| 231 | Ga0466699_198328 | 3300042597 | Bacteria | 1599 |
| 232 | AustNasuHG_c1023217 | 3300000089 | Bacteria | 1983 |
| 233 | JGI24695J34938_10000424 | 3300002450 | Bacteria | 40819 |
| 234 | JGI24702J35022_10123662 | 3300002462 | Bacteria | 1431 |
| 235 | Ga0068302_10038273 | 3300005071 | Bacteria | 5922 |
| 236 | Ga0068305_10013509 | 3300005083 | Bacteria | 19158 |
| 237 | Ga0072940_1065831 | 3300005200 | Bacteria | 8027 |
| 238 | Ga0072941_1080722 | 3300005201 | Bacteria | 2700 |
| 239 | Ga0102734_1000670 | 3300007129 | Bacteria | 18002 |
| 240 | Ga0466735_210528 | 3300042624 | Bacteria | 3133 |
| 241 | Ga0466703_089056 | 3300042636 | Bacteria | 3007 |
| 242 | Ga0466704_067653 | 3300042643 | Bacteria | 11662 |
| 243 | Ga0466708_250775 | 3300042652 | Bacteria | 8451 |
| 244 | Ga0466725_386673 | 3300042654 | Bacteria | 8847 |
| 245 | Ga0466706_254777 | 3300042599 | Bacteria | 3786 |
| 246 | Ga0466707_185312 | 3300042601 | Bacteria | 99373 |
| 247 | Ga0466713_050958 | 3300042602 | Bacteria | 35586 |
| 248 | Ga0466716_451069 | 3300042605 | Bacteria | 1127 |
| 249 | Ga0123357_10156215 | 3300009784 | Bacteria | 2750 |
| 250 | Ga0123355_10354681 | 3300009826 | Bacteria | 1939 |
| 251 | Ga0123356_10005854 | 3300010049 | Bacteria | 12481 |
| 252 | Ga0123356_10054764 | 3300010049 | Bacteria | 3715 |
| 253 | Ga0123354_10003213 | 3300010882 | Bacteria | 22401 |
| 254 | Ga0466710_073598 | 3300042613 | Bacteria | 2176 |
| 255 | Ga0466711_187359 | 3300042615 | Bacteria | 4363 |
| 256 | Ga0466711_494451 | 3300042615 | Bacteria | 3934 |
| 257 | Ga0466715_199371 | 3300042616 | Bacteria | 26460 |
| 258 | Ga0466723_048366 | 3300042618 | Bacteria | 1157 |
| 259 | Ga0466726_137778 | 3300042619 | Bacteria | 1911 |
| 260 | Ga0466726_393936 | 3300042619 | Bacteria | 2448 |
| 261 | Ga0160441_102137 | 3300012825 | Bacteria | 4375 |
| 262 | Ga0415639_105432 | 3300038395 | Bacteria | 2519 |
| 263 | Ga0466690_172990 | 3300042590 | Bacteria | 8573 |
| 264 | Ga0466691_043294 | 3300042593 | Bacteria | 8115 |
| 265 | Ga0466694_052984 | 3300042594 | Bacteria | 5638 |
| 266 | Ga0466695_279394 | 3300042595 | Bacteria | 1196 |
| 267 | Ga0466699_440338 | 3300042597 | Bacteria | 1276 |
| 268 | JGI24705J35276_12238688 | 3300002504 | Bacteria | 37700 |
| 269 | Ga0072941_1060451 | 3300005201 | Bacteria | 10966 |
| 270 | Ga0466734_136730 | 3300042623 | Bacteria | 2724 |
| 271 | Ga0466735_156523 | 3300042624 | Bacteria | 1155 |
| 272 | Ga0466704_019233 | 3300042643 | Bacteria | 11403 |
| 273 | Ga0466704_285004 | 3300042643 | Bacteria | 2224 |
| 274 | Ga0466704_285321 | 3300042643 | Bacteria | 12799 |
| 275 | Ga0466704_450884 | 3300042643 | Bacteria | 7566 |
| 276 | Ga0466708_019590 | 3300042652 | Bacteria | 13952 |
| 277 | Ga0466727_136591 | 3300042655 | Bacteria | 7889 |
| 278 | Ga0466707_222820 | 3300042601 | Bacteria | 15913 |
| 279 | Ga0466717_033077 | 3300042604 | Bacteria | 1830 |
| 280 | Ga0123355_10551007 | 3300009826 | Bacteria | 1394 |
| 281 | Ga0123356_10010808 | 3300010049 | Unclassified | 8927 |
| 282 | Ga0123356_10491130 | 3300010049 | Bacteria | 1382 |
| 283 | Ga0123353_10000304 | 3300010167 | Bacteria | 61195 |
| 284 | Ga0123353_10032674 | 3300010167 | Bacteria | 8086 |
| 285 | Ga0123354_10013745 | 3300010882 | Bacteria | 12582 |
| 286 | Ga0466705_463000 | 3300042612 | Bacteria | 14210 |
| 287 | Ga0466711_030612 | 3300042615 | Bacteria | 3364 |
| 288 | Ga0466723_034648 | 3300042618 | Bacteria | 11027 |
| 289 | Ga0466726_320076 | 3300042619 | Bacteria | 2973 |
| 290 | Ga0160467_100001 | 3300012829 | Bacteria | 1734829 |
| 291 | Ga0160455_100059 | 3300012837 | Bacteria | 208496 |
| 292 | Ga0466690_314749 | 3300042590 | Bacteria | 6667 |
| 293 | Ga0466691_024336 | 3300042593 | Bacteria | 26161 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.