Protein Family IF08529

Metagenome Isolate
123 Members
59 Samples
99 Scaffolds
214.06 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_179085|Ga0466729_179085_24870_25580
Length
236 aa
Sequence
MLPPAMKGRRAARNPQEVRPFMKKAIVGKKLGMTQVFTPDGRLLPVTVIEAGPNTVVQKKTAVKDGYEAIQVGFDAYPEYRVKKLVTKPLLGHFQKAGVAPTRRLREFRLEDCAVYEPGQVIKADVFAEGEKVDVTGISKGHGFTGAIYRWHQHTGPMAHGSKYHRGVGSMGANSTPSRVFKNKHMPGHYGVEKVTVQNLTVVRVDADRNLLLVRGAVPGPNGGYLTVRNAVKAKA

📊 Sample Types

Isolate 19.5%
Metagenome 80.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 44.8%
Termitidae 32.8%
Kalotermitidae 13.8%
Rhinotermitidae 3.4%
Passalidae 3.4%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
4 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
5 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2819999932 Unclassified Synergistetes Th196P4bin51 Isolate Unclassified
10 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
11 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
12 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
13 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
14 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
15 2820439761 Unclassified Firmicutes Lab288P3bin203 Isolate Unclassified
16 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
17 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
18 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
19 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
20 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
21 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
22 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
23 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
26 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
27 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
28 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
29 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
30 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
36 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
40 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
41 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
42 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
46 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
47 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
50 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
51 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
52 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
53 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
54 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
55 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
56 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
57 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
58 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_289904 3300042612 Bacteria 1415
2 Ga0123356_10655794 3300010049 Bacteria 1217
3 Ga0123353_10140292 3300010167 Bacteria 3872
4 Ga0123353_11146507 3300010167 Bacteria 1027
5 Ga0123353_11372053 3300010167 Bacteria 911
6 Ga0466706_023903 3300042599 Bacteria 8621
7 IMNBL1DRAFT_c0011874 3300000062 Bacteria 4029
8 JGI24702J35022_10000046 3300002462 Unclassified 51245
9 Ga0415639_059512 3300038395 Bacteria 1369
10 Ga0466715_321032 3300042616 Bacteria 166710
11 Ga0123355_10494289 3300009826 Unclassified 1513
12 Ga0123356_11740113 3300010049 Bacteria 774
13 Ga0123353_11369353 3300010167 Unclassified 912
14 Ga0466706_094432 3300042599 Bacteria 10061
15 Ga0466722_062688 3300042609 Bacteria 114214
16 Ga0466722_171115 3300042609 Bacteria 2361
17 JGI24697J35500_11273971 3300002507 Bacteria 6293
18 Ga0466715_309594 3300042616 Bacteria 109113
19 Ga0123355_10005533 3300009826 Bacteria 18540
20 Ga0123353_10348843 3300010167 Bacteria 2231
21 Ga0123353_10392069 3300010167 Bacteria 2071
22 Ga0123353_10488467 3300010167 Bacteria 1799
23 Ga0123353_10588748 3300010167 Bacteria 1594
24 IMNBL1DRAFT_c0008644 3300000062 Bacteria 5158
25 JGI24705J35276_12232713 3300002504 Bacteria 4470
26 Ga0466704_384049 3300042643 Bacteria 13703
27 Ga0466724_39977 3300042649 Bacteria 2295
28 Ga0466695_352172 3300042595 Bacteria 4668
29 Ga0466733_104839 3300042659 Bacteria 6841
30 Ga0466733_111442 3300042659 Bacteria 1613
31 Ga0466710_153714 3300042613 Bacteria 1356
32 Ga0123355_10002506 3300009826 Bacteria 26020
33 Ga0123355_10006887 3300009826 Bacteria 16926
34 Ga0123355_10069014 3300009826 Bacteria 5684
35 Ga0123353_10166779 3300010167 Bacteria 3500
36 Ga0123353_10243538 3300010167 Bacteria 2792
37 Ga0123353_10613384 3300010167 Bacteria 1551
38 Ga0466701_079270 3300042598 Bacteria 1424
39 Ga0466714_042852 3300042603 Bacteria 1360
40 Ga0466719_381029 3300042606 Bacteria 20568
41 Ga0466722_263842 3300042609 Bacteria 1422
42 Ga0466698_084201 3300042610 Bacteria 5470
43 Ga0466696_026574 3300042596 Bacteria 48163
44 Ga0466733_162242 3300042659 Bacteria 3158
45 Ga0123355_10003652 3300009826 Bacteria 22170
46 Ga0123355_10201237 3300009826 Bacteria 2909
47 Ga0123356_10137257 3300010049 Bacteria 2406
48 Ga0123356_11206363 3300010049 Bacteria 923
49 Ga0123353_10098704 3300010167 Bacteria 4707
50 Ga0466701_049416 3300042598 Bacteria 3983
51 Ga0466714_021533 3300042603 Bacteria 2222
52 JGI24700J35501_10929970 3300002508 Bacteria 10835
53 Ga0466729_261965 3300042621 Bacteria 1636
54 Ga0466729_156092 3300042621 Bacteria 7836
55 Ga0123355_10164330 3300009826 Bacteria 3335
56 Ga0123355_10473103 3300009826 Bacteria 1564
57 Ga0123355_11243279 3300009826 Unclassified 754
58 Ga0123353_10132411 3300010167 Bacteria 4000
59 Ga0123353_10192937 3300010167 Bacteria 3213
60 Ga0123353_10271919 3300010167 Bacteria 2610
61 Ga0123353_10398417 3300010167 Bacteria 2050
62 Ga0123353_10664303 3300010167 Bacteria 1472
63 Ga0466701_102582 3300042598 Bacteria 1318
64 Ga0466713_131073 3300042602 Bacteria 1837
65 Ga0466714_003503 3300042603 Bacteria 8470
66 Ga0466725_199610 3300042654 Bacteria 2880
67 Ga0466725_458205 3300042654 Bacteria 1001
68 Ga0264413_114079 3300024493 Bacteria 21928
69 Ga0466733_191604 3300042659 Bacteria 1451
70 Ga0123355_10092120 3300009826 Bacteria 4802
71 Ga0123355_10324615 3300009826 Bacteria 2069
72 Ga0123355_10331648 3300009826 Bacteria 2037
73 Ga0123355_10926448 3300009826 Bacteria 941
74 Ga0123356_10089322 3300010049 Bacteria 2932
75 Ga0123353_10548766 3300010167 Bacteria 1668
76 Ga0123354_10010812 3300010882 Bacteria 14085
77 Ga0466716_126380 3300042605 Bacteria 28858
78 Ga0466722_045557 3300042609 Bacteria 252817
79 2227632120 2225789004 Bacteria 2116
80 JGI24703J35330_11746332 3300002501 Bacteria 5162
81 Ga0068305_10072262 3300005083 Bacteria 1267
82 Ga0466725_023926 3300042654 Bacteria 1976
83 Ga0466729_128708 3300042621 Bacteria 4231
84 Ga0466729_179085 3300042621 Bacteria 60360
85 Ga0123355_10013429 3300009826 Bacteria 12744
86 Ga0123355_10103330 3300009826 Bacteria 4479
87 Ga0123356_10018791 3300010049 Unclassified 6558
88 Ga0123356_11651374 3300010049 Bacteria 794
89 Ga0123353_10000953 3300010167 Bacteria 35371
90 Ga0123353_10245978 3300010167 Bacteria 2775
91 Ga0123353_10371658 3300010167 Bacteria 2143
92 Ga0123354_10400439 3300010882 Bacteria 1163
93 Ga0466707_010870 3300042601 Bacteria 3701
94 Ga0466707_313561 3300042601 Bacteria 2732
95 Ga0466719_344301 3300042606 Bacteria 1394
96 IMNBL1DRAFT_c0004808 3300000062 Bacteria 7967
97 JGI24703J35330_11748856 3300002501 Bacteria 55836
98 Ga0466703_035205 3300042636 Bacteria 3955
99 Ga0466657_043905 3300042582 Unclassified 1503

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00297 Ribosomal_L3 Ribosomal protein L3 120 207 0.91

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.