Protein Family IF08506
Metagenome
Isolate
131
Members
54
Samples
127
Scaffolds
227.22
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_117838|Ga0466729_117838_250_1035
- Length
- 261 aa
- Sequence
- MNDAKKKVGMIKERRPCAAKTNLDRKNKIVYTHYIMTLFEFSQKFAEIRQKGFVRTMRNGPTGIGYTLETLLGIRENNDARPDIEGAELKAHRANGNTMITLFTFNNKAWKMPPLEAVKQYGSLDKDGRQGLYYTMSRTPNSAGLFLYVTDSDISVRHISGSIIAEWQMITLSERFHQKLPALIFVSAFTEERDGVEYFNFHRAQLMKGTSTELLADQFRSENILVDLRLHDKGTMARNHGTGFRTFENKLPLLFRNVIDV
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.9%
Kalotermitidae
23.1%
Unclassified
11.5%
Termopsidae
7.7%
Rhinotermitidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
2
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 30 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 35 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 45 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 50 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466734_035600 | 3300042623 | Bacteria | 1491 |
| 2 | Ga0123353_10318289 | 3300010167 | Bacteria | 2363 |
| 3 | Ga0123353_10516199 | 3300010167 | Unclassified | 1735 |
| 4 | Ga0264413_116484 | 3300024493 | Unclassified | 2157 |
| 5 | Ga0466690_019178 | 3300042590 | Bacteria | 2701 |
| 6 | Ga0466690_060048 | 3300042590 | Unclassified | 1592 |
| 7 | Ga0466693_054713 | 3300042592 | Unclassified | 1638 |
| 8 | Ga0466720_037688 | 3300042607 | Unclassified | 3075 |
| 9 | Ga0466720_097061 | 3300042607 | Bacteria | 9592 |
| 10 | AustNasuHG_c1003117 | 3300000089 | Bacteria | 5978 |
| 11 | JGI24698J34947_10047058 | 3300002449 | Bacteria | 2191 |
| 12 | JGI24695J34938_10000922 | 3300002450 | Bacteria | 26884 |
| 13 | JGI24705J35276_12199350 | 3300002504 | Bacteria | 1584 |
| 14 | JGI24705J35276_12216583 | 3300002504 | Bacteria | 2053 |
| 15 | JGI24705J35276_12219498 | 3300002504 | Bacteria | 2208 |
| 16 | Ga0466726_064423 | 3300042619 | Bacteria | 1581 |
| 17 | Ga0466705_117739 | 3300042612 | Bacteria | 20227 |
| 18 | Ga0466735_064039 | 3300042624 | Bacteria | 1773 |
| 19 | Ga0123355_10276954 | 3300009826 | Bacteria | 2322 |
| 20 | Ga0123353_10340654 | 3300010167 | Bacteria | 2264 |
| 21 | Ga0466691_068812 | 3300042593 | Bacteria | 2131 |
| 22 | Ga0466695_108932 | 3300042595 | Bacteria | 2182 |
| 23 | Ga0466696_064874 | 3300042596 | Bacteria | 2162 |
| 24 | Ga0466707_059896 | 3300042601 | Bacteria | 59431 |
| 25 | Ga0466707_410625 | 3300042601 | Bacteria | 1784 |
| 26 | Ga0466721_017655 | 3300042608 | Bacteria | 40620 |
| 27 | Ga0466698_021304 | 3300042610 | Bacteria | 13906 |
| 28 | Ga0466697_027305 | 3300042611 | Bacteria | 2434 |
| 29 | JGI24698J34947_10032860 | 3300002449 | Bacteria | 2723 |
| 30 | Ga0068302_10139048 | 3300005071 | Bacteria | 1841 |
| 31 | Ga0068305_10003759 | 3300005083 | Bacteria | 7155 |
| 32 | Ga0466723_039713 | 3300042618 | Bacteria | 7050 |
| 33 | Ga0466726_162539 | 3300042619 | Bacteria | 3933 |
| 34 | Ga0466726_169010 | 3300042619 | Bacteria | 5365 |
| 35 | Ga0466726_303540 | 3300042619 | Bacteria | 65545 |
| 36 | Ga0466732_051056 | 3300042656 | Bacteria | 3942 |
| 37 | Ga0466732_444135 | 3300042656 | Bacteria | 5200 |
| 38 | Ga0466733_116065 | 3300042659 | Bacteria | 1468 |
| 39 | Ga0466731_253474 | 3300042622 | Bacteria | 2653 |
| 40 | Ga0123357_10222436 | 3300009784 | Bacteria | 2091 |
| 41 | Ga0123354_10036600 | 3300010882 | Bacteria | 7653 |
| 42 | Ga0123354_10074269 | 3300010882 | Bacteria | 4873 |
| 43 | Ga0466690_243327 | 3300042590 | Bacteria | 5111 |
| 44 | Ga0466707_359517 | 3300042601 | Bacteria | 1682 |
| 45 | Ga0466698_024385 | 3300042610 | Bacteria | 2343 |
| 46 | JGI24695J34938_10020068 | 3300002450 | Unclassified | 3295 |
| 47 | Ga0466704_195873 | 3300042643 | Bacteria | 2321 |
| 48 | Ga0466708_068596 | 3300042652 | Bacteria | 25089 |
| 49 | Ga0466727_229231 | 3300042655 | Archaea | 1702 |
| 50 | Ga0123355_10216537 | 3300009826 | Bacteria | 2763 |
| 51 | Ga0466690_322234 | 3300042590 | Bacteria | 2814 |
| 52 | Ga0466721_273892 | 3300042608 | Unclassified | 3191 |
| 53 | Ga0466722_029491 | 3300042609 | Bacteria | 9543 |
| 54 | Ga0072941_1238721 | 3300005201 | Bacteria | 1014 |
| 55 | Ga0466710_139920 | 3300042613 | Bacteria | 3646 |
| 56 | Ga0466711_058431 | 3300042615 | Bacteria | 3457 |
| 57 | Ga0466728_200511 | 3300042620 | Bacteria | 2586 |
| 58 | Ga0466732_397496 | 3300042656 | Bacteria | 11882 |
| 59 | Ga0466733_049330 | 3300042659 | Bacteria | 2122 |
| 60 | Ga0466708_113885 | 3300042652 | Bacteria | 5565 |
| 61 | Ga0123353_10011445 | 3300010167 | Bacteria | 12503 |
| 62 | Ga0466691_139147 | 3300042593 | Bacteria | 13177 |
| 63 | Ga0466707_197573 | 3300042601 | Bacteria | 7790 |
| 64 | Ga0466719_190504 | 3300042606 | Bacteria | 6724 |
| 65 | Ga0466722_088746 | 3300042609 | Bacteria | 9782 |
| 66 | JGI24698J34947_10001413 | 3300002449 | Bacteria | 12652 |
| 67 | JGI24698J34947_10070588 | 3300002449 | Bacteria | 1680 |
| 68 | JGI24695J34938_10007627 | 3300002450 | Bacteria | 6290 |
| 69 | JGI24699J35502_11132900 | 3300002509 | Bacteria | 7906 |
| 70 | Ga0466723_131423 | 3300042618 | Bacteria | 3165 |
| 71 | Ga0466728_035691 | 3300042620 | Bacteria | 34437 |
| 72 | Ga0466729_117838 | 3300042621 | Bacteria | 1420 |
| 73 | Ga0466705_176687 | 3300042612 | Bacteria | 2799 |
| 74 | Ga0123356_10108591 | 3300010049 | Bacteria | 2676 |
| 75 | Ga0123353_11424459 | 3300010167 | Bacteria | 889 |
| 76 | Ga0123354_10145887 | 3300010882 | Unclassified | 2897 |
| 77 | Ga0466656_075323 | 3300042550 | Unclassified | 1148 |
| 78 | Ga0466701_033966 | 3300042598 | Bacteria | 2286 |
| 79 | Ga0466706_190675 | 3300042599 | Bacteria | 1493 |
| 80 | Ga0466720_053978 | 3300042607 | Bacteria | 6097 |
| 81 | Ga0466722_010617 | 3300042609 | Unclassified | 1926 |
| 82 | JGI24698J34947_10081889 | 3300002449 | Unclassified | 1511 |
| 83 | Ga0466712_065088 | 3300042614 | Bacteria | 15347 |
| 84 | Ga0466732_175493 | 3300042656 | Bacteria | 64076 |
| 85 | Ga0466729_287935 | 3300042621 | Bacteria | 3153 |
| 86 | Ga0466702_193329 | 3300042635 | Bacteria | 1848 |
| 87 | Ga0466703_011801 | 3300042636 | Unclassified | 2565 |
| 88 | Ga0466727_087121 | 3300042655 | Bacteria | 3754 |
| 89 | Ga0123356_10265715 | 3300010049 | Bacteria | 1802 |
| 90 | Ga0123354_10055850 | 3300010882 | Bacteria | 5903 |
| 91 | Ga0264413_101590 | 3300024493 | Bacteria | 9399 |
| 92 | Ga0264413_116486 | 3300024493 | Unclassified | 2204 |
| 93 | Ga0466690_051175 | 3300042590 | Bacteria | 2745 |
| 94 | Ga0466691_027141 | 3300042593 | Bacteria | 2525 |
| 95 | Ga0466706_189586 | 3300042599 | Unclassified | 1390 |
| 96 | Ga0466707_131097 | 3300042601 | Bacteria | 1201 |
| 97 | Ga0466707_193359 | 3300042601 | Bacteria | 58762 |
| 98 | Ga0466716_063430 | 3300042605 | Bacteria | 3499 |
| 99 | Ga0466716_341238 | 3300042605 | Bacteria | 2355 |
| 100 | Ga0466720_156418 | 3300042607 | Unclassified | 2231 |
| 101 | Ga0466720_157073 | 3300042607 | Bacteria | 4573 |
| 102 | AustNasuHG_c1000600 | 3300000089 | Bacteria | 12734 |
| 103 | AustNasuHG_c1031583 | 3300000089 | Bacteria | 1492 |
| 104 | Ga0466718_018699 | 3300042617 | Bacteria | 14794 |
| 105 | Ga0466723_018544 | 3300042618 | Bacteria | 4962 |
| 106 | Ga0466726_027240 | 3300042619 | Unclassified | 7312 |
| 107 | Ga0466726_251175 | 3300042619 | Bacteria | 1831 |
| 108 | Ga0466705_064748 | 3300042612 | Bacteria | 2603 |
| 109 | Ga0466732_118738 | 3300042656 | Bacteria | 3286 |
| 110 | Ga0466733_043686 | 3300042659 | Bacteria | 5953 |
| 111 | Ga0466703_281678 | 3300042636 | Bacteria | 4002 |
| 112 | Ga0466704_404243 | 3300042643 | Archaea | 2527 |
| 113 | Ga0123356_10000034 | 3300010049 | Bacteria | 149865 |
| 114 | Ga0123353_10572243 | 3300010167 | Bacteria | 1623 |
| 115 | Ga0466690_107479 | 3300042590 | Bacteria | 2752 |
| 116 | Ga0466693_212797 | 3300042592 | Unclassified | 1175 |
| 117 | Ga0466699_151836 | 3300042597 | Bacteria | 1156 |
| 118 | Ga0466699_327110 | 3300042597 | Bacteria | 3273 |
| 119 | Ga0466707_130969 | 3300042601 | Bacteria | 1883 |
| 120 | Ga0466707_175072 | 3300042601 | Bacteria | 1173 |
| 121 | Ga0466716_413816 | 3300042605 | Bacteria | 9874 |
| 122 | Ga0466720_107577 | 3300042607 | Unclassified | 1382 |
| 123 | Ga0466722_150690 | 3300042609 | Bacteria | 13163 |
| 124 | JGI24698J34947_10142300 | 3300002449 | Unclassified | 1009 |
| 125 | Ga0072941_1003084 | 3300005201 | Unclassified | 7230 |
| 126 | Ga0466718_059662 | 3300042617 | Bacteria | 1474 |
| 127 | Ga0466726_449330 | 3300042619 | Bacteria | 2220 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF15515 | MvaI_BcnI | MvaI/BcnI restriction endonuclease family | 43 | 255 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.