Protein Family IF08474

Metagenome Isolate
251 Members
82 Samples
239 Scaffolds
360.86 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_450298|Ga0466728_450298_977_2239
Length
420 aa
Sequence
VELKINCPAYRKVKLRKNKNISVCEKLKLTTKLHLKLQSQREICNYIYKRVFFIGKRRKTMNIDLHKIPIADLVKDYANYNGEGVKGYGGRLDIRPKYQREFVYNKSQRDAVINSVRSNFPLNVMYWVKNNDESFEVLDGQQRTISICEYIKGGFSIDYKLFENLTNDEQNQILNYELMVYFCEGTDSEKLKWFEIINIAGAVLTEQELRNAVYTGAWLSDAKRYFSKNACPAYQIGSNYLSGTSIRQEYLETALDWISGGNINSYMSKHQQDHDALELWSYFQSVITWVQGKFVKYRKEMKGIDWGKLYNNHKNKTLDPAALEKEIARLMQDDDVTNKKGVYDYVLGGKEKNLNIRYFTVNMKREAYERQKGVCVVCNKYFEIKDMEGDHIKPWHLGGKTTSENCQMLCKDDNRVKSGR

📊 Sample Types

Isolate 4.8%
Metagenome 95.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.2%
Kalotermitidae 17.5%
Unclassified 17.5%
Drosophilidae 6.2%
Rhinotermitidae 5.0%
Termopsidae 5.0%
Formicidae 3.8%
Hodotermitidae 1.2%
Elmidae 1.2%
Kiwaidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 225
Eukaryota 0
Viruses 1
Unclassified 25

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
28 2820263778 Unclassified Firmicutes Th196P3bin37 Isolate Unclassified
29 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
30 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
35 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
42 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
43 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
44 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
45 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
46 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
47 3300005317 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut Metagenome Drosophilidae
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
51 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
52 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
53 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
54 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
55 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
56 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
57 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
58 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
59 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
60 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
61 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
62 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
63 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
66 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
67 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
68 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
69 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
70 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
71 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
72 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
73 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
74 3300005314 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut Metagenome Drosophilidae
75 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
76 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
77 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
78 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
79 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
80 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
81 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
82 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10003031 3300002449 Bacteria 9099
2 Ga0068305_10116236 3300005083 Unclassified 5717
3 Ga0072941_1002413 3300005201 Bacteria 23202
4 Ga0072941_1002897 3300005201 Unclassified 2603
5 Ga0072941_1008625 3300005201 Bacteria 17269
6 Ga0072941_1055080 3300005201 Unclassified 3867
7 Ga0074311_1035064 3300005317 Bacteria 7194
8 Ga0102739_1000075 3300007095 Bacteria 27585
9 Ga0123353_10105224 3300010167 Bacteria 4547
10 Ga0466712_142035 3300042614 Bacteria 1929
11 Ga0466712_276397 3300042614 Bacteria 3955
12 Ga0466715_345350 3300042616 Bacteria 6856
13 Ga0466723_090744 3300042618 Bacteria 8755
14 Ga0466726_070208 3300042619 Bacteria 3606
15 Ga0466726_099654 3300042619 Bacteria 5915
16 Ga0466729_111422 3300042621 Unclassified 1360
17 Ga0466706_022859 3300042599 Bacteria 3587
18 Ga0466706_110338 3300042599 Bacteria 42217
19 Ga0466706_289458 3300042599 Bacteria 3154
20 Ga0466714_074814 3300042603 Bacteria 4147
21 Ga0466714_164698 3300042603 Bacteria 45780
22 Ga0466716_258817 3300042605 Bacteria 1712
23 Ga0466716_259512 3300042605 Bacteria 1613
24 Ga0466731_101248 3300042622 Bacteria 2727
25 Ga0466702_467002 3300042635 Bacteria 2683
26 Ga0466703_348751 3300042636 Unclassified 2160
27 Ga0466725_404638 3300042654 Bacteria 2952
28 Ga0415639_037948 3300038395 Bacteria 12417
29 Ga0456237_0012159 3300041968 Unclassified 1248
30 Ga0466692_011255 3300042591 Unclassified 4152
31 Ga0466692_114785 3300042591 Bacteria 1674
32 Ga0466693_101951 3300042592 Bacteria 8509
33 Ga0466691_181785 3300042593 Bacteria 2409
34 Ga0466694_259218 3300042594 Bacteria 76481
35 Ga0466696_172889 3300042596 Bacteria 1682
36 Ga0466696_352538 3300042596 Bacteria 1727
37 JGI24703J35330_11738448 3300002501 Bacteria 3199
38 Ga0072940_1070151 3300005200 Bacteria 1885
39 Ga0072940_1266086 3300005200 Bacteria 1256
40 Ga0072941_1104327 3300005201 Bacteria 3581
41 Ga0074309_1001840 3300005314 Bacteria 4621
42 Ga0123353_10390096 3300010167 Bacteria 2078
43 Ga0123353_10453374 3300010167 Bacteria 1887
44 Ga0123353_10641663 3300010167 Bacteria 1506
45 Ga0466726_008874 3300042619 Bacteria 15690
46 Ga0466726_032723 3300042619 Bacteria 2602
47 Ga0466726_122006 3300042619 Bacteria 2330
48 Ga0466726_428666 3300042619 Bacteria 1330
49 Ga0466706_066856 3300042599 Bacteria 111854
50 Ga0466706_129288 3300042599 Bacteria 1522
51 Ga0466719_410509 3300042606 Bacteria 1829
52 Ga0466720_005971 3300042607 Bacteria 3886
53 Ga0466721_266423 3300042608 Bacteria 3399
54 Ga0466735_056016 3300042624 Unclassified 2990
55 Ga0466702_074922 3300042635 Bacteria 5425
56 Ga0466709_067608 3300042648 Bacteria 24200
57 Ga0264413_126308 3300024493 Bacteria 2476
58 Ga0466692_002937 3300042591 Bacteria 9782
59 Ga0466695_113483 3300042595 Bacteria 5931
60 Ga0466696_014381 3300042596 Bacteria 34007
61 Ga0466696_068899 3300042596 Bacteria 4311
62 Ga0466696_194807 3300042596 Bacteria 2684
63 Ga0466696_380290 3300042596 Bacteria 5695
64 Ga0466705_194770 3300042612 Bacteria 2856
65 Ga0466732_017907 3300042656 Bacteria 4857
66 Ga0466732_334739 3300042656 Bacteria 4134
67 JGI24702J35022_10011412 3300002462 Bacteria 4951
68 Ga0068302_10078731 3300005071 Unclassified 3850
69 Ga0072940_1481915 3300005200 Bacteria 2052
70 Ga0072941_1292263 3300005201 Bacteria 4423
71 Ga0123355_10024201 3300009826 Bacteria 9757
72 Ga0123353_10120368 3300010167 Bacteria 4221
73 Ga0123353_10678260 3300010167 Bacteria 1452
74 Ga0466712_276521 3300042614 Unclassified 1343
75 Ga0466726_143110 3300042619 Bacteria 1923
76 Ga0466728_120536 3300042620 Bacteria 1981
77 Ga0466706_054025 3300042599 Bacteria 59903
78 Ga0466707_244726 3300042601 Unclassified 1399
79 Ga0466714_123525 3300042603 Bacteria 14779
80 Ga0466716_109836 3300042605 Bacteria 5905
81 Ga0466720_115899 3300042607 Unclassified 9182
82 Ga0466697_045657 3300042611 Bacteria 1573
83 Ga0466729_259433 3300042621 Bacteria 1374
84 Ga0466702_024114 3300042635 Bacteria 2467
85 Ga0466702_279070 3300042635 Bacteria 4094
86 Ga0466727_035311 3300042655 Bacteria 2155
87 Ga0466727_233164 3300042655 Bacteria 8519
88 Ga0264413_129461 3300024493 Unclassified 1667
89 Ga0466692_126204 3300042591 Bacteria 7651
90 Ga0466691_052032 3300042593 Bacteria 4603
91 Ga0466691_161649 3300042593 Bacteria 6514
92 Ga0466694_012091 3300042594 Bacteria 9466
93 Ga0466733_075624 3300042659 Bacteria 3357
94 AustNasuHG_c1000046 3300000089 Bacteria 31091
95 JGI24698J34947_10017738 3300002449 Bacteria 3854
96 JGI24698J34947_10046190 3300002449 Bacteria 2217
97 JGI24702J35022_10014048 3300002462 Bacteria 4424
98 Ga0068302_10250322 3300005071 Bacteria 2171
99 Ga0072940_1014016 3300005200 Bacteria 2284
100 Ga0072941_1010292 3300005201 Bacteria 17879
101 Ga0072941_1118123 3300005201 Bacteria 3979
102 Ga0123357_10016031 3300009784 Bacteria 9845
103 Ga0123357_10052084 3300009784 Bacteria 5528
104 Ga0123355_10008301 3300009826 Bacteria 15695
105 Ga0123356_10116515 3300010049 Bacteria 2591
106 Ga0123356_10317120 3300010049 Bacteria 1670
107 Ga0466712_001179 3300042614 Bacteria 19392
108 Ga0466712_160358 3300042614 Bacteria 4323
109 Ga0466715_403982 3300042616 Bacteria 1523
110 Ga0466701_064384 3300042598 Bacteria 2345
111 Ga0466706_008446 3300042599 Bacteria 1714
112 Ga0466706_148617 3300042599 Bacteria 5364
113 Ga0466713_104038 3300042602 Bacteria 3056
114 Ga0466720_050028 3300042607 Bacteria 93115
115 Ga0466730_032726 3300042625 Bacteria 7305
116 Ga0466703_229082 3300042636 Bacteria 1548
117 Ga0466704_100855 3300042643 Bacteria 2433
118 Ga0466657_276592 3300042582 Bacteria 5737
119 Ga0466690_010723 3300042590 Bacteria 7069
120 Ga0466690_032673 3300042590 Bacteria 3051
121 Ga0466690_115324 3300042590 Bacteria 4070
122 Ga0466692_066220 3300042591 Bacteria 18291
123 Ga0466692_154242 3300042591 Unclassified 5667
124 Ga0466695_259182 3300042595 Bacteria 4877
125 Ga0466699_322668 3300042597 Unclassified 2326
126 Ga0466732_059032 3300042656 Bacteria 3089
127 JGI24698J34947_10009526 3300002449 Bacteria 5330
128 JGI24702J35022_10009915 3300002462 Bacteria 5338
129 JGI24702J35022_10014165 3300002462 Bacteria 4403
130 JGI24702J35022_10022949 3300002462 Bacteria 3374
131 JGI24702J35022_10025783 3300002462 Bacteria 3169
132 JGI24700J35501_10928270 3300002508 Bacteria 7510
133 Ga0068305_10017931 3300005083 Bacteria 6030
134 Ga0068305_10061415 3300005083 Bacteria 1718
135 Ga0072940_1032415 3300005200 Bacteria 5513
136 Ga0072940_1244091 3300005200 Bacteria 2220
137 Ga0123353_10016960 3300010167 Bacteria 10674
138 Ga0466712_240703 3300042614 Bacteria 5670
139 Ga0466712_318207 3300042614 Bacteria 18982
140 Ga0466718_090492 3300042617 Bacteria 14162
141 Ga0466726_065157 3300042619 Bacteria 2254
142 Ga0466707_001487 3300042601 Bacteria 3839
143 Ga0466713_129904 3300042602 Unclassified 2169
144 Ga0466721_022826 3300042608 Bacteria 9077
145 Ga0466722_064483 3300042609 Bacteria 235903
146 Ga0466702_410598 3300042635 Unclassified 4553
147 Ga0466727_291575 3300042655 Bacteria 1989
148 Ga0157631_144727 3300013007 Bacteria 3687
149 JGI24698J34947_10007138 3300002449 Bacteria 6138
150 JGI24698J34947_10085157 3300002449 Bacteria 1469
151 JGI24702J35022_10019653 3300002462 Bacteria 3673
152 Ga0072940_1053662 3300005200 Bacteria 10054
153 Ga0072940_1169061 3300005200 Bacteria 2111
154 Ga0072941_1157704 3300005201 Bacteria 1517
155 Ga0104019_1004003 3300007150 Bacteria 4376
156 Ga0105005_1013861 3300007505 Bacteria 3728
157 Ga0123356_10444566 3300010049 Bacteria 1443
158 Ga0123353_10264157 3300010167 Unclassified 2656
159 Ga0466712_093032 3300042614 Bacteria 8233
160 Ga0466715_212323 3300042616 Bacteria 5730
161 Ga0466718_085096 3300042617 Bacteria 2247
162 Ga0466726_477468 3300042619 Bacteria 2788
163 Ga0466707_055433 3300042601 Bacteria 1625
164 Ga0466713_015290 3300042602 Bacteria 2361
165 Ga0466713_055092 3300042602 Bacteria 4910
166 Ga0466713_066351 3300042602 Bacteria 7859
167 Ga0466720_059875 3300042607 Bacteria 16278
168 Ga0466702_148332 3300042635 Bacteria 1743
169 Ga0466703_204344 3300042636 Bacteria 20557
170 Ga0466703_397275 3300042636 Bacteria 4905
171 Ga0466704_188287 3300042643 Bacteria 11036
172 Ga0466709_171572 3300042648 Bacteria 4209
173 Ga0466725_360251 3300042654 Bacteria 1821
174 Ga0415639_065125 3300038395 Bacteria 6852
175 Ga0466695_203159 3300042595 Bacteria 2292
176 Ga0466705_187890 3300042612 Bacteria 1442
177 Ga0466705_229828 3300042612 Bacteria 2385
178 Ga0466732_030948 3300042656 Bacteria 5675
179 Ga0466733_145997 3300042659 Bacteria 4444
180 2230954199 2228664003 Bacteria 18711
181 JGI24695J34938_10018441 3300002450 Bacteria 3488
182 JGI24695J34938_10026377 3300002450 Bacteria 2762
183 Ga0072940_1026132 3300005200 Bacteria 6697
184 Ga0072941_1004826 3300005201 Bacteria 38591
185 Ga0072941_1182974 3300005201 Bacteria 2131
186 Ga0102734_1003045 3300007129 Bacteria 3847
187 Ga0104048_1001564 3300007143 Bacteria 2440
188 Ga0105005_1295105 3300007505 Unclassified 1209
189 Ga0466711_234090 3300042615 Bacteria 5456
190 Ga0466715_428264 3300042616 Bacteria 33860
191 Ga0466718_047254 3300042617 Bacteria 3047
192 Ga0466718_110062 3300042617 Bacteria 2005
193 Ga0466723_297937 3300042618 Bacteria 5720
194 Ga0466726_086640 3300042619 Bacteria 9772
195 Ga0466726_149102 3300042619 Bacteria 3847
196 Ga0466726_383461 3300042619 Bacteria 1335
197 Ga0466701_016258 3300042598 Bacteria 2127
198 Ga0466706_114204 3300042599 Bacteria 16495
199 Ga0466706_208252 3300042599 Bacteria 5664
200 Ga0466707_013850 3300042601 Bacteria 7181
201 Ga0466707_125792 3300042601 Bacteria 1352
202 Ga0466720_089154 3300042607 Bacteria 23341
203 Ga0466731_271365 3300042622 Bacteria 1959
204 Ga0466734_123940 3300042623 Unclassified 3409
205 Ga0466725_100570 3300042654 Bacteria 5224
206 Ga0264413_104956 3300024493 Bacteria 3751
207 Ga0415639_012791 3300038395 Bacteria 12772
208 Ga0466693_164138 3300042592 Bacteria 2343
209 Ga0466694_075927 3300042594 Bacteria 4113
210 Ga0466694_208185 3300042594 Bacteria 1830
211 Ga0466697_127490 3300042611 Bacteria 2922
212 Ga0466732_153254 3300042656 Bacteria 3467
213 Ga0466733_158517 3300042659 Bacteria 2654
214 JGI24698J34947_10009571 3300002449 Unclassified 5317
215 JGI24695J34938_10023081 3300002450 Bacteria 3005
216 Ga0068305_10003141 3300005083 Bacteria 16262
217 Ga0072941_1011057 3300005201 Bacteria 7720
218 Ga0103265_1000624 3300007068 Bacteria 5955
219 Ga0102734_1000318 3300007129 Viruses 14375
220 Ga0123354_10000504 3300010882 Bacteria 39326
221 Ga0123354_10027492 3300010882 Bacteria 8961
222 Ga0466718_170475 3300042617 Bacteria 104587
223 Ga0466723_276653 3300042618 Bacteria 86412
224 Ga0466728_018310 3300042620 Unclassified 8164
225 Ga0466728_054926 3300042620 Bacteria 3570
226 Ga0466728_450298 3300042620 Bacteria 2706
227 Ga0466706_286102 3300042599 Unclassified 1736
228 Ga0466713_082163 3300042602 Bacteria 21357
229 Ga0466713_151380 3300042602 Bacteria 12093
230 Ga0466714_031419 3300042603 Unclassified 1806
231 Ga0466720_127763 3300042607 Bacteria 3424
232 Ga0466721_159351 3300042608 Bacteria 1454
233 Ga0466722_131823 3300042609 Bacteria 2268
234 Ga0466729_316329 3300042621 Bacteria 1905
235 Ga0466735_168327 3300042624 Bacteria 16588
236 Ga0466703_132290 3300042636 Unclassified 1283
237 Ga0466708_304003 3300042652 Bacteria 21176
238 Ga0466708_421664 3300042652 Bacteria 6155
239 Ga0466691_131804 3300042593 Bacteria 6284

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042602 Ga0466713_082163 Ga0466713_082163_11101_11997 298
2 3300042614 Ga0466712_276521 Ga0466712_276521_39_938 299
3 3300010882 Ga0123354_10027492 Ga0123354_100274927 303
4 3300024493 Ga0264413_126308 Ga0264413_1263083 306
5 3300042619 Ga0466726_122006 Ga0466726_122006_629_1570 313
6 3300042607 Ga0466720_005971 Ga0466720_005971_1375_2472 321
7 3300042607 Ga0466720_050028 Ga0466720_050028_42615_43712 323
8 3300042619 Ga0466726_086640 Ga0466726_086640_7175_8173 332
9 3300042615 Ga0466711_234090 Ga0466711_234090_2643_3791 341
10 3300042619 Ga0466726_070208 Ga0466726_070208_1512_2591 343
11 3300005201 Ga0072941_1182974 Ga0072941_11829742 344
12 3300042619 Ga0466726_428666 Ga0466726_428666_93_1127 344
13 3300007505 Ga0105005_1013861 Ga0105005_10138614 345
14 3300005200 Ga0072940_1481915 Ga0072940_14819152 348
15 3300042596 Ga0466696_014381 Ga0466696_014381_6435_7553 350
16 3300042596 Ga0466696_352538 Ga0466696_352538_568_1650 350
17 3300042612 Ga0466705_194770 Ga0466705_194770_224_1333 351
18 3300042619 Ga0466726_032723 Ga0466726_032723_1468_2523 351
19 3300002501 JGI24703J35330_11738448 JGI24703J35330_117384482 353
20 3300005200 Ga0072940_1244091 Ga0072940_12440912 356
21 3300042621 Ga0466729_316329 Ga0466729_316329_110_1180 356
22 3300005201 Ga0072941_1104327 Ga0072941_11043272 357
23 3300042595 Ga0466695_203159 Ga0466695_203159_256_1332 358
24 3300042601 Ga0466707_013850 Ga0466707_013850_4856_5932 358
25 3300042603 Ga0466714_074814 Ga0466714_074814_70_1146 358
26 3300042611 Ga0466697_045657 Ga0466697_045657_350_1426 358
27 3300042611 Ga0466697_127490 Ga0466697_127490_694_1770 358
28 3300042623 Ga0466734_123940 Ga0466734_123940_2156_3232 358
29 3300042624 Ga0466735_168327 Ga0466735_168327_9849_10925 358
30 3300042635 Ga0466702_148332 Ga0466702_148332_582_1658 358
31 2228664003 2230954199 2230659607 359
32 3300010167 Ga0123353_10390096 Ga0123353_103900962 359
33 3300042590 Ga0466690_115324 Ga0466690_115324_713_1792 359
34 3300042594 Ga0466694_012091 Ga0466694_012091_152_1231 359
35 3300042594 Ga0466694_075927 Ga0466694_075927_2217_3296 359
36 3300042595 Ga0466695_113483 Ga0466695_113483_3341_4420 359
37 3300042597 Ga0466699_322668 Ga0466699_322668_464_1543 359
38 3300042601 Ga0466707_001487 Ga0466707_001487_2014_3093 359
39 3300042601 Ga0466707_125792 Ga0466707_125792_180_1259 359
40 3300042605 Ga0466716_109836 Ga0466716_109836_3211_4290 359
41 3300042607 Ga0466720_059875 Ga0466720_059875_262_1341 359
42 3300042607 Ga0466720_115899 Ga0466720_115899_5469_6548 359
43 3300042607 Ga0466720_127763 Ga0466720_127763_1387_2466 359
44 3300042608 Ga0466721_022826 Ga0466721_022826_2264_3343 359
45 3300042609 Ga0466722_131823 Ga0466722_131823_502_1581 359
46 3300042614 Ga0466712_093032 Ga0466712_093032_4116_5195 359
47 3300042614 Ga0466712_142035 Ga0466712_142035_720_1799 359
48 3300042648 Ga0466709_171572 Ga0466709_171572_2483_3562 359
49 3300042656 Ga0466732_017907 Ga0466732_017907_3604_4683 359
50 3300042656 Ga0466732_030948 Ga0466732_030948_3944_5023 359
51 3300042656 Ga0466732_059032 Ga0466732_059032_441_1520 359
52 3300042656 Ga0466732_153254 Ga0466732_153254_1270_2349 359
53 3300042656 Ga0466732_334739 Ga0466732_334739_348_1427 359
54 3300042659 Ga0466733_075624 Ga0466733_075624_1313_2392 359
55 iso_pr_bacteria 2781125631 2781268159 359
56 3300002449 JGI24698J34947_10003031 JGI24698J34947_100030314 360
57 3300002449 JGI24698J34947_10009526 JGI24698J34947_100095263 360
58 3300002449 JGI24698J34947_10009571 JGI24698J34947_100095715 360
59 3300002449 JGI24698J34947_10017738 JGI24698J34947_100177383 360
60 3300002450 JGI24695J34938_10018441 JGI24695J34938_100184413 360
61 3300002450 JGI24695J34938_10023081 JGI24695J34938_100230812 360
62 3300005200 Ga0072940_1014016 Ga0072940_10140163 360
63 3300005200 Ga0072940_1169061 Ga0072940_11690612 360
64 3300005201 Ga0072941_1002897 Ga0072941_10028973 360
65 3300005201 Ga0072941_1011057 Ga0072941_10110577 360
66 3300005201 Ga0072941_1055080 Ga0072941_10550804 360
67 3300005314 Ga0074309_1001840 Ga0074309_10018404 360
68 3300007150 Ga0104019_1004003 Ga0104019_10040033 360
69 3300024493 Ga0264413_129461 Ga0264413_1294611 360
70 3300041968 Ga0456237_0012159 Ga0456237_0012159_104_1186 360
71 3300042582 Ga0466657_276592 Ga0466657_276592_3581_4663 360
72 3300042590 Ga0466690_010723 Ga0466690_010723_1078_2160 360
73 3300042590 Ga0466690_032673 Ga0466690_032673_193_1275 360
74 3300042591 Ga0466692_011255 Ga0466692_011255_1673_2755 360
75 3300042591 Ga0466692_126204 Ga0466692_126204_291_1373 360
76 3300042591 Ga0466692_154242 Ga0466692_154242_2698_3780 360
77 3300042593 Ga0466691_052032 Ga0466691_052032_3295_4377 360
78 3300042593 Ga0466691_131804 Ga0466691_131804_2986_4068 360
79 3300042593 Ga0466691_161649 Ga0466691_161649_618_1700 360
80 3300042595 Ga0466695_259182 Ga0466695_259182_177_1259 360
81 3300042596 Ga0466696_068899 Ga0466696_068899_2076_3158 360
82 3300042596 Ga0466696_194807 Ga0466696_194807_305_1387 360
83 3300042596 Ga0466696_380290 Ga0466696_380290_2828_3910 360
84 3300042599 Ga0466706_110338 Ga0466706_110338_30606_31688 360
85 3300042599 Ga0466706_148617 Ga0466706_148617_684_1766 360
86 3300042601 Ga0466707_244726 Ga0466707_244726_73_1155 360
87 3300042603 Ga0466714_123525 Ga0466714_123525_7898_8980 360
88 3300042605 Ga0466716_259512 Ga0466716_259512_465_1547 360
89 3300042607 Ga0466720_089154 Ga0466720_089154_4837_5919 360
90 3300042608 Ga0466721_159351 Ga0466721_159351_165_1247 360
91 3300042609 Ga0466722_064483 Ga0466722_064483_192391_193473 360
92 3300042612 Ga0466705_187890 Ga0466705_187890_155_1237 360
93 3300042614 Ga0466712_160358 Ga0466712_160358_1814_2896 360
94 3300042614 Ga0466712_240703 Ga0466712_240703_971_2053 360
95 3300042614 Ga0466712_276397 Ga0466712_276397_1603_2685 360
96 3300042617 Ga0466718_110062 Ga0466718_110062_198_1280 360
97 3300042617 Ga0466718_170475 Ga0466718_170475_59881_60963 360
98 3300042618 Ga0466723_090744 Ga0466723_090744_4393_5475 360
99 3300042618 Ga0466723_276653 Ga0466723_276653_80473_81555 360
100 3300042618 Ga0466723_297937 Ga0466723_297937_4434_5570 360
101 3300042619 Ga0466726_065157 Ga0466726_065157_193_1275 360
102 3300042619 Ga0466726_149102 Ga0466726_149102_1482_2564 360
103 3300042619 Ga0466726_383461 Ga0466726_383461_177_1259 360
104 3300042619 Ga0466726_477468 Ga0466726_477468_308_1390 360
105 3300042620 Ga0466728_120536 Ga0466728_120536_657_1739 360
106 3300042621 Ga0466729_111422 Ga0466729_111422_93_1175 360
107 3300042621 Ga0466729_259433 Ga0466729_259433_72_1154 360
108 3300042622 Ga0466731_101248 Ga0466731_101248_351_1433 360
109 3300042624 Ga0466735_056016 Ga0466735_056016_543_1625 360
110 3300042625 Ga0466730_032726 Ga0466730_032726_6044_7126 360
111 3300042635 Ga0466702_279070 Ga0466702_279070_2758_3840 360
112 3300042636 Ga0466703_229082 Ga0466703_229082_101_1183 360
113 3300042643 Ga0466704_100855 Ga0466704_100855_287_1369 360
114 3300042643 Ga0466704_188287 Ga0466704_188287_6030_7112 360
115 3300042648 Ga0466709_067608 Ga0466709_067608_6722_7804 360
116 3300042652 Ga0466708_304003 Ga0466708_304003_5839_6921 360
117 3300042652 Ga0466708_421664 Ga0466708_421664_2871_3953 360
118 3300042655 Ga0466727_233164 Ga0466727_233164_7388_8470 360
119 3300042659 Ga0466733_158517 Ga0466733_158517_115_1197 360
120 iso_pr_bacteria 2740892546 2743910897 360
121 iso_pr_bacteria 2819994798 2819995706 360
122 iso_pr_bacteria 2820724199 2820724868 360
123 3300000089 AustNasuHG_c1000046 AustNasuHG_10000466 361
124 3300002449 JGI24698J34947_10085157 JGI24698J34947_100851572 361
125 3300002462 JGI24702J35022_10009915 JGI24702J35022_100099154 361
126 3300002462 JGI24702J35022_10011412 JGI24702J35022_100114124 361
127 3300002462 JGI24702J35022_10014048 JGI24702J35022_100140482 361
128 3300002462 JGI24702J35022_10025783 JGI24702J35022_100257832 361
129 3300002508 JGI24700J35501_10928270 JGI24700J35501_109282705 361
130 3300005071 Ga0068302_10250322 Ga0068302_102503222 361
131 3300005083 Ga0068305_10017931 Ga0068305_100179314 361
132 3300005200 Ga0072940_1032415 Ga0072940_10324153 361
133 3300005200 Ga0072940_1070151 Ga0072940_10701512 361
134 3300005200 Ga0072940_1266086 Ga0072940_12660862 361
135 3300005201 Ga0072941_1002413 Ga0072941_100241315 361
136 3300005201 Ga0072941_1004826 Ga0072941_100482619 361
137 3300005201 Ga0072941_1008625 Ga0072941_10086257 361
138 3300005201 Ga0072941_1010292 Ga0072941_101029211 361
139 3300005201 Ga0072941_1157704 Ga0072941_11577042 361
140 3300005201 Ga0072941_1292263 Ga0072941_12922633 361
141 3300007095 Ga0102739_1000075 Ga0102739_100007524 361
142 3300007129 Ga0102734_1003045 Ga0102734_10030452 361
143 3300007143 Ga0104048_1001564 Ga0104048_10015641 361
144 3300007505 Ga0105005_1295105 Ga0105005_12951052 361
145 3300010049 Ga0123356_10116515 Ga0123356_101165151 361
146 3300010167 Ga0123353_10105224 Ga0123353_101052243 361
147 3300010167 Ga0123353_10120368 Ga0123353_101203682 361
148 3300010167 Ga0123353_10678260 Ga0123353_106782602 361
149 3300042592 Ga0466693_101951 Ga0466693_101951_6158_7243 361
150 3300042598 Ga0466701_016258 Ga0466701_016258_80_1165 361
151 3300042619 Ga0466726_008874 Ga0466726_008874_14049_15134 361
152 3300042655 Ga0466727_035311 Ga0466727_035311_358_1443 361
153 3300002462 JGI24702J35022_10019653 JGI24702J35022_100196533 362
154 3300007068 Ga0103265_1000624 Ga0103265_10006242 362
155 3300013007 Ga0157631_144727 Ga0157631_1447272 362
156 3300042591 Ga0466692_002937 Ga0466692_002937_7127_8215 362
157 3300042599 Ga0466706_289458 Ga0466706_289458_1643_2731 362
158 3300042602 Ga0466713_151380 Ga0466713_151380_5087_6175 362
159 3300038395 Ga0415639_065125 Ga0415639_065125_1768_2859 363
160 3300042592 Ga0466693_164138 Ga0466693_164138_568_1659 363
161 3300042602 Ga0466713_066351 Ga0466713_066351_1818_2909 363
162 3300042602 Ga0466713_129904 Ga0466713_129904_540_1631 363
163 3300042603 Ga0466714_164698 Ga0466714_164698_14492_15583 363
164 iso_pr_bacteria 2820522177 2820524555 363
165 3300009826 Ga0123355_10008301 Ga0123355_1000830112 364
166 3300009826 Ga0123355_10024201 Ga0123355_1002420110 364
167 3300038395 Ga0415639_037948 Ga0415639_037948_8537_9631 364
168 3300042593 Ga0466691_181785 Ga0466691_181785_1162_2256 364
169 3300042594 Ga0466694_259218 Ga0466694_259218_41717_42811 364
170 3300042599 Ga0466706_008446 Ga0466706_008446_604_1698 364
171 3300042599 Ga0466706_286102 Ga0466706_286102_39_1133 364
172 3300042616 Ga0466715_212323 Ga0466715_212323_2478_3572 364
173 3300042619 Ga0466726_099654 Ga0466726_099654_3615_4709 364
174 3300042635 Ga0466702_410598 Ga0466702_410598_2635_3729 364
175 3300042636 Ga0466703_204344 Ga0466703_204344_15556_16650 364
176 3300042636 Ga0466703_348751 Ga0466703_348751_924_2018 364
177 3300042654 Ga0466725_100570 Ga0466725_100570_275_1369 364
178 3300042655 Ga0466727_291575 Ga0466727_291575_637_1731 364
179 iso_pr_bacteria 2820280018 2820280333 364
180 3300002449 JGI24698J34947_10007138 JGI24698J34947_100071382 365
181 3300005071 Ga0068302_10078731 Ga0068302_100787312 365
182 3300005083 Ga0068305_10116236 Ga0068305_101162364 365
183 3300005200 Ga0072940_1053662 Ga0072940_10536622 365
184 3300009784 Ga0123357_10016031 Ga0123357_100160317 365
185 3300010167 Ga0123353_10453374 Ga0123353_104533741 365
186 3300024493 Ga0264413_104956 Ga0264413_1049562 365
187 3300042591 Ga0466692_066220 Ga0466692_066220_288_1385 365
188 3300042599 Ga0466706_114204 Ga0466706_114204_2767_3864 365
189 3300042599 Ga0466706_208252 Ga0466706_208252_4411_5508 365
190 3300042602 Ga0466713_055092 Ga0466713_055092_837_1934 365
191 3300042602 Ga0466713_104038 Ga0466713_104038_1775_2872 365
192 3300042603 Ga0466714_031419 Ga0466714_031419_502_1599 365
193 3300042614 Ga0466712_001179 Ga0466712_001179_9898_10995 365
194 3300042616 Ga0466715_428264 Ga0466715_428264_30348_31445 365
195 3300042636 Ga0466703_132290 Ga0466703_132290_93_1190 365
196 3300002449 JGI24698J34947_10046190 JGI24698J34947_100461901 366
197 3300002462 JGI24702J35022_10014165 JGI24702J35022_100141654 366
198 3300005083 Ga0068305_10003141 Ga0068305_100031418 366
199 3300005083 Ga0068305_10061415 Ga0068305_100614152 366
200 3300038395 Ga0415639_012791 Ga0415639_012791_3699_4799 366
201 3300042616 Ga0466715_403982 Ga0466715_403982_274_1374 366
202 3300042620 Ga0466728_054926 Ga0466728_054926_1653_2753 366
203 3300010049 Ga0123356_10317120 Ga0123356_103171201 367
204 3300042598 Ga0466701_064384 Ga0466701_064384_470_1573 367
205 3300042602 Ga0466713_015290 Ga0466713_015290_1037_2140 367
206 3300042608 Ga0466721_266423 Ga0466721_266423_1036_2139 367
207 3300042612 Ga0466705_229828 Ga0466705_229828_849_1952 367
208 3300042620 Ga0466728_018310 Ga0466728_018310_5056_6159 367
209 3300042635 Ga0466702_024114 Ga0466702_024114_1135_2238 367
210 3300042635 Ga0466702_074922 Ga0466702_074922_1320_2423 367
211 3300042635 Ga0466702_467002 Ga0466702_467002_979_2082 367
212 3300042636 Ga0466703_397275 Ga0466703_397275_2009_3112 367
213 3300042654 Ga0466725_360251 Ga0466725_360251_263_1366 367
214 3300002450 JGI24695J34938_10026377 JGI24695J34938_100263773 368
215 3300002462 JGI24702J35022_10022949 JGI24702J35022_100229494 368
216 3300007129 Ga0102734_1000318 Ga0102734_10003186 368
217 3300042599 Ga0466706_054025 Ga0466706_054025_22217_23323 368
218 3300042599 Ga0466706_066856 Ga0466706_066856_58012_59118 368
219 3300042614 Ga0466712_318207 Ga0466712_318207_9286_10392 368
220 3300042654 Ga0466725_404638 Ga0466725_404638_363_1469 368
221 iso_pr_bacteria 2740892547 2743913490 368
222 iso_pr_bacteria 2820360414 2820360431 368
223 iso_pr_bacteria 2820420508 2820421321 368
224 iso_pr_bacteria 2864804954 2864808001 368
225 3300005200 Ga0072940_1026132 Ga0072940_10261322 369
226 3300005201 Ga0072941_1118123 Ga0072941_11181233 369
227 3300005317 Ga0074311_1035064 Ga0074311_10350645 369
228 3300010167 Ga0123353_10016960 Ga0123353_100169604 369
229 3300042601 Ga0466707_055433 Ga0466707_055433_66_1175 369
230 iso_pr_bacteria 2820263778 2820264123 369
231 3300042594 Ga0466694_208185 Ga0466694_208185_595_1707 370
232 3300042599 Ga0466706_022859 Ga0466706_022859_1806_2918 370
233 3300042617 Ga0466718_047254 Ga0466718_047254_881_1993 370
234 3300042617 Ga0466718_090492 Ga0466718_090492_12320_13432 370
235 iso_pr_bacteria 2820833147 2820834180 370
236 3300010167 Ga0123353_10264157 Ga0123353_102641571 371
237 3300010882 Ga0123354_10000504 Ga0123354_1000050412 371
238 3300009784 Ga0123357_10052084 Ga0123357_100520844 372
239 3300042596 Ga0466696_172889 Ga0466696_172889_314_1432 372
240 3300042616 Ga0466715_345350 Ga0466715_345350_3060_4178 372
241 3300042622 Ga0466731_271365 Ga0466731_271365_23_1141 372
242 3300010167 Ga0123353_10641663 Ga0123353_106416632 373
243 3300042591 Ga0466692_114785 Ga0466692_114785_525_1646 373
244 3300042605 Ga0466716_258817 Ga0466716_258817_525_1646 373
245 3300042606 Ga0466719_410509 Ga0466719_410509_366_1487 373
246 3300042619 Ga0466726_143110 Ga0466726_143110_268_1389 373
247 3300042599 Ga0466706_129288 Ga0466706_129288_21_1157 378
248 3300042617 Ga0466718_085096 Ga0466718_085096_772_1908 378
249 3300010049 Ga0123356_10444566 Ga0123356_104445661 379
250 3300042659 Ga0466733_145997 Ga0466733_145997_1790_2971 393
251 3300042620 Ga0466728_450298 Ga0466728_450298_977_2239 420

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01844 HNH HNH endonuclease 375 418 0.95
PF14279 HNH_5 HNH endonuclease 375 414 0.94
PF03235 DUF262 Protein of unknown function DUF262 94 214 0.78

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.