Protein Family IF08471
Metagenome
Isolate
117
Members
65
Samples
98
Scaffolds
157.56
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_443831|Ga0466728_443831_10011_10580
- Length
- 189 aa
- Sequence
- MRLLLGKKTIFSCKIKITEYICFPKKTKMIQEIERKFLVSGDFKPFVSESIRIAQAYLSSVPERTVRVRIKGDKGYITVKGIAGDSGVSRFEWEKEIPLSEAQELLKICEPGVIDKTRHLILAGNHTFEVDEFHGENEGLIIAEIELDSEDEPFEKPFWLGREVTGDAEYYNSMLMKNPYIKWRTASRL
Sample Types
Isolate
16.2%
Metagenome
83.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.3%
Kalotermitidae
20.0%
Unclassified
15.4%
Blattidae
9.2%
Rhinotermitidae
6.2%
Apidae
4.6%
Passalidae
4.6%
Elmidae
3.1%
Hodotermitidae
1.5%
Tenebrionidae
1.5%
Drosophilidae
1.5%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 2 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 15 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 16 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 25 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 34 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 35 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 40 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 41 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 42 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 43 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 44 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 45 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 51 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 52 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 53 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 54 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 55 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 56 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 57 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 58 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 59 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 60 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 61 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 62 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 63 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 64 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 65 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_172709 | 3300042621 | Bacteria | 2625 |
| 2 | Ga0466706_281467 | 3300042599 | Bacteria | 24001 |
| 3 | Ga0466700_361949 | 3300042600 | Bacteria | 4355 |
| 4 | Ga0466714_048622 | 3300042603 | Bacteria | 56206 |
| 5 | Ga0466714_072449 | 3300042603 | Bacteria | 2332 |
| 6 | Ga0466717_172510 | 3300042604 | Bacteria | 1564 |
| 7 | HBC_ctgsDRAFT_1000036 | 3300000333 | Bacteria | 33162 |
| 8 | JGI24695J34938_10373910 | 3300002450 | Bacteria | 630 |
| 9 | Ga0466725_362383 | 3300042654 | Bacteria | 1727 |
| 10 | Ga0123357_10010182 | 3300009784 | Bacteria | 11937 |
| 11 | Ga0123356_12422671 | 3300010049 | Bacteria | 657 |
| 12 | Ga0123353_10033243 | 3300010167 | Bacteria | 8027 |
| 13 | Ga0123353_10267422 | 3300010167 | Bacteria | 2637 |
| 14 | Ga0123354_10280813 | 3300010882 | Bacteria | 1617 |
| 15 | Ga0466710_334256 | 3300042613 | Bacteria | 7504 |
| 16 | Ga0466715_084192 | 3300042616 | Bacteria | 39268 |
| 17 | Ga0466657_100103 | 3300042582 | Bacteria | 2183 |
| 18 | Ga0466713_043591 | 3300042602 | Bacteria | 53812 |
| 19 | IMNBL1DRAFT_c0013460 | 3300000062 | Bacteria | 3667 |
| 20 | Ga0466709_240386 | 3300042648 | Bacteria | 67601 |
| 21 | Ga0123357_10023323 | 3300009784 | Bacteria | 8313 |
| 22 | Ga0123356_11297578 | 3300010049 | Bacteria | 891 |
| 23 | Ga0123354_10325078 | 3300010882 | Bacteria | 1412 |
| 24 | Ga0466715_504379 | 3300042616 | Bacteria | 25514 |
| 25 | Ga0466692_052636 | 3300042591 | Unclassified | 1062 |
| 26 | Ga0466714_155862 | 3300042603 | Bacteria | 8190 |
| 27 | JGI24702J35022_10010712 | 3300002462 | Bacteria | 5120 |
| 28 | Ga0074302_1155534 | 3300005316 | Bacteria | 711 |
| 29 | Ga0466704_378204 | 3300042643 | Bacteria | 2757 |
| 30 | Ga0466704_450066 | 3300042643 | Bacteria | 15714 |
| 31 | Ga0123357_10019436 | 3300009784 | Bacteria | 9053 |
| 32 | Ga0123357_10022743 | 3300009784 | Bacteria | 8409 |
| 33 | Ga0123357_10613423 | 3300009784 | Unclassified | 827 |
| 34 | Ga0123354_10031483 | 3300010882 | Bacteria | 8320 |
| 35 | Ga0123354_10064274 | 3300010882 | Unclassified | 5383 |
| 36 | Ga0123354_10231862 | 3300010882 | Bacteria | 1927 |
| 37 | Ga0466733_053780 | 3300042659 | Bacteria | 2582 |
| 38 | Ga0466733_202133 | 3300042659 | Bacteria | 5014 |
| 39 | Ga0466690_392368 | 3300042590 | Bacteria | 11841 |
| 40 | Ga0466706_156116 | 3300042599 | Bacteria | 30046 |
| 41 | Ga0466713_035594 | 3300042602 | Bacteria | 13747 |
| 42 | Ga0466716_095419 | 3300042605 | Bacteria | 3826 |
| 43 | Ga0466722_109950 | 3300042609 | Bacteria | 8778 |
| 44 | Ga0466730_001511 | 3300042625 | Bacteria | 4025 |
| 45 | Ga0123357_10004689 | 3300009784 | Bacteria | 16145 |
| 46 | Ga0123356_10330376 | 3300010049 | Bacteria | 1641 |
| 47 | Ga0123356_10620659 | 3300010049 | Unclassified | 1247 |
| 48 | Ga0123353_10287169 | 3300010167 | Unclassified | 2521 |
| 49 | Ga0466697_228790 | 3300042611 | Bacteria | 1095 |
| 50 | Ga0466728_156336 | 3300042620 | Bacteria | 1326 |
| 51 | JGI24705J35276_12149923 | 3300002504 | Bacteria | 1178 |
| 52 | Ga0466729_198321 | 3300042621 | Bacteria | 8895 |
| 53 | Ga0466734_140707 | 3300042623 | Bacteria | 1030 |
| 54 | Ga0466725_246159 | 3300042654 | Bacteria | 1463 |
| 55 | Ga0123355_10384354 | 3300009826 | Bacteria | 1826 |
| 56 | Ga0123356_10471102 | 3300010049 | Bacteria | 1407 |
| 57 | Ga0123353_10845812 | 3300010167 | Unclassified | 1255 |
| 58 | Ga0466705_132153 | 3300042612 | Bacteria | 1390 |
| 59 | Ga0466733_094328 | 3300042659 | Bacteria | 1320 |
| 60 | Ga0466710_382177 | 3300042613 | Bacteria | 1302 |
| 61 | Ga0466719_061695 | 3300042606 | Bacteria | 12823 |
| 62 | IMNBL1DRAFT_c0000452 | 3300000062 | Bacteria | 34320 |
| 63 | JGI24702J35022_10034882 | 3300002462 | Bacteria | 2690 |
| 64 | Ga0068305_10000024 | 3300005083 | Bacteria | 79054 |
| 65 | Ga0466725_026613 | 3300042654 | Bacteria | 1672 |
| 66 | Ga0123357_10132665 | 3300009784 | Bacteria | 3094 |
| 67 | Ga0123355_10021039 | 3300009826 | Bacteria | 10434 |
| 68 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 69 | Ga0466712_265657 | 3300042614 | Bacteria | 2203 |
| 70 | Ga0466728_443831 | 3300042620 | Bacteria | 12126 |
| 71 | Ga0466700_381383 | 3300042600 | Bacteria | 7002 |
| 72 | Ga0466700_411124 | 3300042600 | Unclassified | 2967 |
| 73 | Ga0466713_016116 | 3300042602 | Bacteria | 46967 |
| 74 | Ga0466713_109231 | 3300042602 | Bacteria | 188899 |
| 75 | 2227041492 | 2225789003 | Unclassified | 4198 |
| 76 | JGI24702J35022_10001870 | 3300002462 | Bacteria | 12958 |
| 77 | JGI24702J35022_10691978 | 3300002462 | Bacteria | 633 |
| 78 | JGI24705J35276_12235256 | 3300002504 | Bacteria | 6341 |
| 79 | JGI24705J35276_12236368 | 3300002504 | Bacteria | 7928 |
| 80 | Ga0466704_244375 | 3300042643 | Unclassified | 1216 |
| 81 | Ga0466724_56743 | 3300042649 | Bacteria | 1936 |
| 82 | Ga0466708_049337 | 3300042652 | Bacteria | 27530 |
| 83 | Ga0123357_10060854 | 3300009784 | Bacteria | 5063 |
| 84 | Ga0123353_10000005 | 3300010167 | Bacteria | 308504 |
| 85 | Ga0123353_11284869 | 3300010167 | Bacteria | 952 |
| 86 | Ga0466711_111542 | 3300042615 | Bacteria | 1712 |
| 87 | Ga0466715_115168 | 3300042616 | Bacteria | 14737 |
| 88 | Ga0466723_287950 | 3300042618 | Bacteria | 10333 |
| 89 | Ga0466691_107034 | 3300042593 | Bacteria | 1964 |
| 90 | Ga0466696_121761 | 3300042596 | Bacteria | 1379 |
| 91 | Ga0466700_454173 | 3300042600 | Bacteria | 3078 |
| 92 | Ga0466713_072003 | 3300042602 | Bacteria | 72866 |
| 93 | Ga0466722_180460 | 3300042609 | Bacteria | 23698 |
| 94 | Ga0466698_109727 | 3300042610 | Bacteria | 2489 |
| 95 | 2227119145 | 2225789004 | Unclassified | 1709 |
| 96 | Ga0068305_10185621 | 3300005083 | Bacteria | 1147 |
| 97 | Ga0123357_10215799 | 3300009784 | Bacteria | 2142 |
| 98 | Ga0123356_12603645 | 3300010049 | Unclassified | 633 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01928 | CYTH | CYTH domain | 31 | 163 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.