Protein Family IF08434

Metagenome Isolate
133 Members
47 Samples
128 Scaffolds
159.99 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_230092|Ga0466728_230092_734_1288
Length
184 aa
Sequence
VPIIHPPATYDPKLRYTGPINERRSAVRIPRVYIETSVFNFYFADNDPEKQRDTRKFFDEIRNGKYETFTSDYVLRELARASEPKRSRMIGLIEEYAITILPLSEDARVLADAYVAEGVIPKKYLMDGIHIAMTTVFSLNFIVSFNFEHIVKRKTIDMTGIINYKYNYQTVGIFSPTEVIENEG

📊 Sample Types

Isolate 3.8%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 63.8%
Unclassified 14.9%
Kalotermitidae 12.8%
Rhinotermitidae 4.3%
Hodotermitidae 2.1%
Termopsidae 2.1%

🌳 Taxonomy

Archaea 4
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
2 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
3 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
14 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
18 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
19 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
23 2773857680 Unclassified Methanomassiliicoccaceae Emb289P3bin41 Isolate Unclassified
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
35 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
38 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
39 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
40 2820176377 Unclassified Planctomycetes Th196P3bin111 Isolate Unclassified
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_039663 3300042656 Bacteria 2033
2 Ga0466714_147787 3300042603 Bacteria 1406
3 Ga0415639_047575 3300038395 Unclassified 1411
4 Ga0466656_203562 3300042550 Unclassified 2036
5 Ga0466657_246240 3300042582 Archaea 1705
6 Ga0466710_062028 3300042613 Bacteria 1141
7 Ga0466711_131075 3300042615 Unclassified 1425
8 Ga0123355_10951525 3300009826 Bacteria 922
9 Ga0123356_10046751 3300010049 Bacteria 4027
10 Ga0123353_10414671 3300010167 Bacteria 1998
11 Ga0123353_10579140 3300010167 Bacteria 1611
12 Ga0123354_10011346 3300010882 Bacteria 13757
13 Ga0123354_10472406 3300010882 Bacteria 998
14 Ga0466734_061034 3300042623 Bacteria 1076
15 Ga0466702_286863 3300042635 Bacteria 2569
16 Ga0466704_272631 3300042643 Bacteria 1815
17 Ga0466704_300070 3300042643 Bacteria 1125
18 Ga0466704_326767 3300042643 Bacteria 13662
19 Ga0072940_1136545 3300005200 Bacteria 946
20 Ga0072940_1188261 3300005200 Bacteria 1622
21 Ga0466733_075819 3300042659 Bacteria 1888
22 Ga0466733_168890 3300042659 Bacteria 1450
23 Ga0466700_442927 3300042600 Archaea 4472
24 Ga0466717_010940 3300042604 Unclassified 1022
25 Ga0466717_017836 3300042604 Bacteria 7250
26 Ga0466721_193088 3300042608 Bacteria 1058
27 Ga0466705_502490 3300042612 Bacteria 1294
28 Ga0466711_023218 3300042615 Bacteria 29251
29 Ga0466718_055532 3300042617 Unclassified 3723
30 Ga0123356_10142281 3300010049 Bacteria 2368
31 Ga0123356_11492160 3300010049 Bacteria 834
32 Ga0123353_10200022 3300010167 Bacteria 3144
33 Ga0123353_10667558 3300010167 Bacteria 1467
34 Ga0123354_10852499 3300010882 Bacteria 605
35 Ga0466702_143362 3300042635 Bacteria 3454
36 Ga0466704_592101 3300042643 Bacteria 4696
37 JGI24702J35022_10030055 3300002462 Bacteria 2915
38 JGI24696J40584_12954067 3300002834 Unclassified 2579
39 Ga0072940_1056432 3300005200 Bacteria 6905
40 Ga0466733_177177 3300042659 Bacteria 1430
41 Ga0466733_187883 3300042659 Unclassified 1483
42 Ga0466714_058089 3300042603 Bacteria 1413
43 Ga0466698_219459 3300042610 Bacteria 3040
44 Ga0415639_005760 3300038395 Bacteria 8798
45 Ga0466712_009227 3300042614 Bacteria 27493
46 Ga0466726_220721 3300042619 Bacteria 1345
47 Ga0123355_10601350 3300009826 Bacteria 1305
48 Ga0123353_10079299 3300010167 Bacteria 5278
49 Ga0123353_11017976 3300010167 Bacteria 1111
50 Ga0123353_11499193 3300010167 Bacteria 859
51 Ga0123353_11575448 3300010167 Bacteria 831
52 Ga0466734_153521 3300042623 Archaea 9408
53 2230954282 2228664003 Bacteria 4160
54 JGI24702J35022_10030551 3300002462 Bacteria 2890
55 Ga0072940_1029929 3300005200 Bacteria 4942
56 Ga0466707_413624 3300042601 Bacteria 2495
57 Ga0466699_361442 3300042597 Bacteria 2282
58 Ga0466718_066643 3300042617 Bacteria 5159
59 Ga0466723_085112 3300042618 Bacteria 3750
60 Ga0123355_10638510 3300009826 Bacteria 1248
61 Ga0123355_10653800 3300009826 Bacteria 1226
62 Ga0123355_11110179 3300009826 Bacteria 821
63 Ga0123356_10814031 3300010049 Bacteria 1105
64 Ga0123356_11697222 3300010049 Bacteria 783
65 Ga0123353_10832068 3300010167 Bacteria 1269
66 Ga0123353_11516314 3300010167 Bacteria 853
67 Ga0466705_022466 3300042612 Bacteria 12597
68 Ga0466705_061061 3300042612 Bacteria 3108
69 Ga0466731_161404 3300042622 Bacteria 2517
70 Ga0466702_078021 3300042635 Bacteria 3622
71 Ga0466703_039848 3300042636 Bacteria 3302
72 JGI24699J35502_11038978 3300002509 Unclassified 1561
73 Ga0466706_220395 3300042599 Unclassified 1253
74 Ga0466714_022927 3300042603 Bacteria 2598
75 Ga0466698_110676 3300042610 Bacteria 1399
76 Ga0415639_030829 3300038395 Unclassified 3987
77 Ga0466692_170261 3300042591 Bacteria 1091
78 Ga0466711_315666 3300042615 Bacteria 1720
79 Ga0123355_10045766 3300009826 Bacteria 7116
80 Ga0123355_11774588 3300009826 Bacteria 584
81 Ga0123356_10002193 3300010049 Bacteria 21003
82 Ga0123353_10233099 3300010167 Bacteria 2868
83 Ga0123353_10808828 3300010167 Bacteria 1292
84 Ga0123353_10944495 3300010167 Bacteria 1167
85 Ga0123353_11451439 3300010167 Bacteria 878
86 Ga0466734_090784 3300042623 Bacteria 1708
87 JGI24698J34947_10038725 3300002449 Bacteria 2472
88 JGI24698J34947_10293804 3300002449 Unclassified 588
89 JGI24695J34938_10040907 3300002450 Bacteria 2084
90 JGI24702J35022_10025504 3300002462 Bacteria 3189
91 Ga0466732_075708 3300042656 Bacteria 1856
92 Ga0466733_014240 3300042659 Bacteria 1761
93 Ga0415639_007456 3300038395 Bacteria 14124
94 Ga0466699_048433 3300042597 Bacteria 1485
95 Ga0466728_230092 3300042620 Bacteria 1838
96 Ga0123356_10775021 3300010049 Bacteria 1130
97 Ga0123356_12610922 3300010049 Bacteria 632
98 Ga0123353_11204222 3300010167 Bacteria 993
99 Ga0123353_11246390 3300010167 Bacteria 971
100 Ga0466734_153860 3300042623 Bacteria 1364
101 JGI24698J34947_10213370 3300002449 Bacteria 746
102 Ga0466714_043483 3300042603 Bacteria 1395
103 Ga0466717_069965 3300042604 Bacteria 1237
104 Ga0466721_251509 3300042608 Bacteria 170691
105 Ga0466711_433415 3300042615 Bacteria 3937
106 Ga0466718_005834 3300042617 Bacteria 1223
107 Ga0123356_10063711 3300010049 Bacteria 3445
108 Ga0123356_10086583 3300010049 Bacteria 2974
109 Ga0123356_10514276 3300010049 Bacteria 1355
110 Ga0123353_12375073 3300010167 Bacteria 635
111 Ga0466731_081068 3300042622 Bacteria 1113
112 Ga0466704_584556 3300042643 Bacteria 1436
113 Ga0466700_370743 3300042600 Bacteria 1649
114 Ga0466713_060399 3300042602 Bacteria 52732
115 Ga0466721_364338 3300042608 Unclassified 1526
116 Ga0466722_141151 3300042609 Bacteria 4199
117 Ga0466722_172663 3300042609 Bacteria 1908
118 Ga0466698_055025 3300042610 Bacteria 1682
119 Ga0466693_299153 3300042592 Bacteria 1949
120 Ga0466694_093031 3300042594 Unclassified 1607
121 Ga0466699_263045 3300042597 Bacteria 1087
122 Ga0123356_10163521 3300010049 Bacteria 2227
123 Ga0123356_10850656 3300010049 Bacteria 1083
124 Ga0123356_10893431 3300010049 Bacteria 1060
125 Ga0123356_12771887 3300010049 Bacteria 613
126 Ga0123353_10410663 3300010167 Bacteria 2010
127 Ga0123353_11584168 3300010167 Bacteria 828
128 Ga0123354_10173100 3300010882 Bacteria 2502

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002834 JGI24696J40584_12954067 JGI24696J40584_129540672 135
2 3300010167 Ga0123353_10579140 Ga0123353_105791404 147
3 3300042601 Ga0466707_413624 Ga0466707_413624_1136_1579 147
4 3300042609 Ga0466722_172663 Ga0466722_172663_239_682 147
5 3300042615 Ga0466711_131075 Ga0466711_131075_374_817 147
6 3300042615 Ga0466711_433415 Ga0466711_433415_2881_3324 147
7 3300042619 Ga0466726_220721 Ga0466726_220721_787_1230 147
8 3300009826 Ga0123355_10638510 Ga0123355_106385102 148
9 3300010167 Ga0123353_11499193 Ga0123353_114991932 148
10 3300042612 Ga0466705_022466 Ga0466705_022466_1301_1747 148
11 3300042603 Ga0466714_058089 Ga0466714_058089_275_727 150
12 3300038395 Ga0415639_030829 Ga0415639_030829_1622_2077 151
13 3300042609 Ga0466722_141151 Ga0466722_141151_31_486 151
14 3300010049 Ga0123356_10063711 Ga0123356_100637116 152
15 3300010049 Ga0123356_10514276 Ga0123356_105142763 152
16 3300042608 Ga0466721_193088 Ga0466721_193088_515_973 152
17 3300010167 Ga0123353_10414671 Ga0123353_104146713 153
18 3300038395 Ga0415639_047575 Ga0415639_047575_216_680 154
19 3300042604 Ga0466717_069965 Ga0466717_069965_459_929 156
20 3300042635 Ga0466702_143362 Ga0466702_143362_2697_3167 156
21 2228664003 2230954282 2230660364 157
22 3300010167 Ga0123353_10200022 Ga0123353_102000225 157
23 3300042617 Ga0466718_055532 Ga0466718_055532_673_1146 157
24 3300042617 Ga0466718_066643 Ga0466718_066643_2297_2770 157
25 3300042618 Ga0466723_085112 Ga0466723_085112_1795_2268 157
26 3300042623 Ga0466734_153521 Ga0466734_153521_262_735 157
27 3300042635 Ga0466702_078021 Ga0466702_078021_1749_2222 157
28 3300042643 Ga0466704_272631 Ga0466704_272631_1129_1602 157
29 3300042656 Ga0466732_039663 Ga0466732_039663_1409_1882 157
30 iso_pr_bacteria 2820590132 2820591500 157
31 iso_pu_archaea 2773857680 2774151299 157
32 3300005200 Ga0072940_1029929 Ga0072940_10299294 158
33 3300005200 Ga0072940_1136545 Ga0072940_11365451 158
34 3300009826 Ga0123355_10601350 Ga0123355_106013502 158
35 3300009826 Ga0123355_11774588 Ga0123355_117745882 158
36 3300010049 Ga0123356_10002193 Ga0123356_100021935 158
37 3300010049 Ga0123356_10163521 Ga0123356_101635214 158
38 3300010167 Ga0123353_10667558 Ga0123353_106675582 158
39 3300010882 Ga0123354_10011346 Ga0123354_100113466 158
40 3300010882 Ga0123354_10852499 Ga0123354_108524992 158
41 3300038395 Ga0415639_005760 Ga0415639_005760_7692_8168 158
42 3300042592 Ga0466693_299153 Ga0466693_299153_561_1037 158
43 3300042597 Ga0466699_048433 Ga0466699_048433_727_1203 158
44 3300042597 Ga0466699_263045 Ga0466699_263045_328_804 158
45 3300042597 Ga0466699_361442 Ga0466699_361442_996_1472 158
46 3300042599 Ga0466706_220395 Ga0466706_220395_536_1012 158
47 3300042600 Ga0466700_442927 Ga0466700_442927_3047_3523 158
48 3300042604 Ga0466717_010940 Ga0466717_010940_285_761 158
49 3300042608 Ga0466721_251509 Ga0466721_251509_29909_30385 158
50 3300042610 Ga0466698_055025 Ga0466698_055025_970_1446 158
51 3300042610 Ga0466698_110676 Ga0466698_110676_782_1258 158
52 3300042612 Ga0466705_061061 Ga0466705_061061_2184_2660 158
53 3300042613 Ga0466710_062028 Ga0466710_062028_489_965 158
54 3300042614 Ga0466712_009227 Ga0466712_009227_4682_5158 158
55 3300042615 Ga0466711_023218 Ga0466711_023218_4155_4631 158
56 3300042656 Ga0466732_075708 Ga0466732_075708_1008_1484 158
57 3300042659 Ga0466733_075819 Ga0466733_075819_484_960 158
58 iso_pr_bacteria 2820176377 2820176410 158
59 iso_pr_bacteria 2820275298 2820276631 158
60 3300002449 JGI24698J34947_10038725 JGI24698J34947_100387254 159
61 3300002449 JGI24698J34947_10213370 JGI24698J34947_102133701 159
62 3300002449 JGI24698J34947_10293804 JGI24698J34947_102938041 159
63 3300002450 JGI24695J34938_10040907 JGI24695J34938_100409072 159
64 3300002462 JGI24702J35022_10025504 JGI24702J35022_100255041 159
65 3300002462 JGI24702J35022_10030055 JGI24702J35022_100300555 159
66 3300002509 JGI24699J35502_11038978 JGI24699J35502_110389782 159
67 3300005200 Ga0072940_1188261 Ga0072940_11882613 159
68 3300009826 Ga0123355_10653800 Ga0123355_106538002 159
69 3300010049 Ga0123356_10775021 Ga0123356_107750212 159
70 3300010049 Ga0123356_10850656 Ga0123356_108506562 159
71 3300010049 Ga0123356_11492160 Ga0123356_114921601 159
72 3300010049 Ga0123356_11697222 Ga0123356_116972221 159
73 3300010049 Ga0123356_12771887 Ga0123356_127718871 159
74 3300010167 Ga0123353_10079299 Ga0123353_100792993 159
75 3300010167 Ga0123353_10233099 Ga0123353_102330993 159
76 3300010167 Ga0123353_10410663 Ga0123353_104106634 159
77 3300010167 Ga0123353_10832068 Ga0123353_108320682 159
78 3300010167 Ga0123353_11017976 Ga0123353_110179762 159
79 3300010167 Ga0123353_11246390 Ga0123353_112463901 159
80 3300010167 Ga0123353_11516314 Ga0123353_115163142 159
81 3300010167 Ga0123353_11575448 Ga0123353_115754482 159
82 3300042591 Ga0466692_170261 Ga0466692_170261_346_825 159
83 3300042600 Ga0466700_370743 Ga0466700_370743_897_1376 159
84 3300042603 Ga0466714_022927 Ga0466714_022927_1351_1830 159
85 3300042603 Ga0466714_043483 Ga0466714_043483_407_886 159
86 3300042603 Ga0466714_147787 Ga0466714_147787_174_653 159
87 3300042615 Ga0466711_315666 Ga0466711_315666_786_1265 159
88 3300042622 Ga0466731_161404 Ga0466731_161404_1280_1759 159
89 3300042636 Ga0466703_039848 Ga0466703_039848_98_577 159
90 3300042643 Ga0466704_300070 Ga0466704_300070_462_941 159
91 3300042643 Ga0466704_592101 Ga0466704_592101_986_1465 159
92 3300002462 JGI24702J35022_10030551 JGI24702J35022_100305513 160
93 3300005200 Ga0072940_1056432 Ga0072940_10564324 160
94 3300009826 Ga0123355_10045766 Ga0123355_100457664 160
95 3300009826 Ga0123355_10951525 Ga0123355_109515252 160
96 3300010049 Ga0123356_10086583 Ga0123356_100865833 160
97 3300010049 Ga0123356_10142281 Ga0123356_101422811 160
98 3300010049 Ga0123356_10893431 Ga0123356_108934312 160
99 3300010167 Ga0123353_10808828 Ga0123353_108088282 160
100 3300010167 Ga0123353_10944495 Ga0123353_109444953 160
101 3300010167 Ga0123353_11451439 Ga0123353_114514392 160
102 3300010167 Ga0123353_12375073 Ga0123353_123750731 160
103 3300010882 Ga0123354_10472406 Ga0123354_104724062 160
104 3300042643 Ga0466704_326767 Ga0466704_326767_1501_1983 160
105 3300042659 Ga0466733_168890 Ga0466733_168890_705_1187 160
106 iso_pr_bacteria 2820005795 2820006572 160
107 3300010049 Ga0123356_12610922 Ga0123356_126109222 161
108 3300042602 Ga0466713_060399 Ga0466713_060399_45110_45595 161
109 3300042623 Ga0466734_090784 Ga0466734_090784_968_1453 161
110 3300010167 Ga0123353_11204222 Ga0123353_112042222 162
111 3300042643 Ga0466704_584556 Ga0466704_584556_540_1028 162
112 3300010049 Ga0123356_10046751 Ga0123356_100467516 163
113 3300042604 Ga0466717_017836 Ga0466717_017836_4212_4703 163
114 3300042659 Ga0466733_187883 Ga0466733_187883_854_1345 163
115 3300009826 Ga0123355_11110179 Ga0123355_111101791 164
116 3300042610 Ga0466698_219459 Ga0466698_219459_1088_1582 164
117 3300042594 Ga0466694_093031 Ga0466694_093031_1017_1514 165
118 3300010049 Ga0123356_10814031 Ga0123356_108140313 166
119 3300042623 Ga0466734_153860 Ga0466734_153860_173_679 168
120 3300042659 Ga0466733_014240 Ga0466733_014240_1016_1525 169
121 3300042623 Ga0466734_061034 Ga0466734_061034_223_735 170
122 3300038395 Ga0415639_007456 Ga0415639_007456_4209_4727 172
123 3300042659 Ga0466733_177177 Ga0466733_177177_221_739 172
124 3300042582 Ga0466657_246240 Ga0466657_246240_414_941 175
125 3300042608 Ga0466721_364338 Ga0466721_364338_362_892 176
126 3300042612 Ga0466705_502490 Ga0466705_502490_452_982 176
127 3300042622 Ga0466731_081068 Ga0466731_081068_332_862 176
128 3300042617 Ga0466718_005834 Ga0466718_005834_129_671 180
129 3300010882 Ga0123354_10173100 Ga0123354_101731001 181
130 3300042620 Ga0466728_230092 Ga0466728_230092_734_1288 184
131 3300042550 Ga0466656_203562 Ga0466656_203562_412_972 186
132 3300010167 Ga0123353_11584168 Ga0123353_115841681 187
133 3300042635 Ga0466702_286863 Ga0466702_286863_984_1661 225

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.