Protein Family IF08425
Metagenome
Isolate
264
Members
111
Samples
235
Scaffolds
207.31
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_181251|Ga0466728_181251_14027_14704
- Length
- 225 aa
- Sequence
- MVAVRPRSAGFKENRTVARNLDPKCRQCRREGEKLFLKGEKCFTDKCAIERRSYAPGQHGQKSGARLSDYGVHLRAKQKIRRVYGVLEGQFRRTFAEAERRKGQTGENLLQLLEARLDSVAYRMGFGASRTEARQVVRHNGVLVNGKRVNIPSYTVCPGDVVSLTDSARGHLRVKAALEAAESRGFPEWIAVDVKEGKGTFKAMPQRAELSPTLNEGLVIELYSK
Sample Types
Isolate
11.0%
Metagenome
89.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.8%
Unclassified
26.9%
Kalotermitidae
13.5%
Formicidae
12.5%
Armadillidiidae
3.8%
Rhinotermitidae
2.9%
Culicidae
2.9%
Termopsidae
2.9%
Curculionidae
1.9%
Elmidae
1.0%
Hydrophilidae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
227
Eukaryota
0
Viruses
0
Unclassified
37
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 2 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 3 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 4 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 5 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 6 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 7 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 8 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 19 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 20 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 21 | 2820170025 | Unclassified Proteobacteria Co191P1bin43 | Isolate | Unclassified |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 26 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 27 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 28 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 33 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 43 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 44 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 45 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 46 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 47 | 2820166269 | Unclassified Proteobacteria Co191P4bin16 | Isolate | Unclassified |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 51 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 52 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 57 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 58 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 61 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 62 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 63 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 64 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 65 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 66 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 67 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 68 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 69 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 70 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 71 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 72 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 73 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 74 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 75 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 76 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 77 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 79 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 80 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 81 | 2820168331 | Unclassified Proteobacteria Co191P3bin57 | Isolate | Unclassified |
| 82 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 83 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 84 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 85 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 86 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 87 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 88 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 89 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 90 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 91 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 92 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 93 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 94 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 95 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 96 | 2820053807 | Unclassified Proteobacteria Th196P3bin117 | Isolate | Unclassified |
| 97 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 98 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 99 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 100 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 101 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 102 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 103 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 104 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 105 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 106 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 107 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 108 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 109 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 110 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 111 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10112952 | 3300010167 | Bacteria | 4373 |
| 2 | Ga0123353_10414851 | 3300010167 | Bacteria | 1998 |
| 3 | Ga0160440_100241 | 3300012815 | Bacteria | 37696 |
| 4 | Ga0160467_105288 | 3300012829 | Unclassified | 1657 |
| 5 | Ga0466657_015831 | 3300042582 | Bacteria | 1731 |
| 6 | Ga0466657_087579 | 3300042582 | Bacteria | 8880 |
| 7 | Ga0466657_108328 | 3300042582 | Bacteria | 20292 |
| 8 | Ga0466692_184437 | 3300042591 | Bacteria | 20938 |
| 9 | Ga0466703_118467 | 3300042636 | Bacteria | 10986 |
| 10 | Ga0466703_229272 | 3300042636 | Bacteria | 5877 |
| 11 | Ga0466703_254472 | 3300042636 | Bacteria | 9059 |
| 12 | Ga0466704_261747 | 3300042643 | Bacteria | 1268 |
| 13 | Ga0466709_187716 | 3300042648 | Unclassified | 5180 |
| 14 | Ga0466708_088956 | 3300042652 | Bacteria | 13799 |
| 15 | Ga0466708_308504 | 3300042652 | Bacteria | 17035 |
| 16 | Ga0466705_424237 | 3300042612 | Bacteria | 1625 |
| 17 | Ga0466710_075507 | 3300042613 | Bacteria | 36861 |
| 18 | Ga0466710_205004 | 3300042613 | Bacteria | 1295 |
| 19 | Ga0466711_406135 | 3300042615 | Bacteria | 4899 |
| 20 | Ga0466711_425235 | 3300042615 | Bacteria | 23654 |
| 21 | Ga0466723_124011 | 3300042618 | Bacteria | 17539 |
| 22 | Ga0466723_126870 | 3300042618 | Bacteria | 23222 |
| 23 | Ga0466726_017072 | 3300042619 | Bacteria | 3043 |
| 24 | Ga0466717_122732 | 3300042604 | Bacteria | 7513 |
| 25 | Ga0466717_146973 | 3300042604 | Unclassified | 1486 |
| 26 | Ga0466719_047699 | 3300042606 | Bacteria | 11168 |
| 27 | Ga0466719_079825 | 3300042606 | Bacteria | 11953 |
| 28 | Ga0466719_257292 | 3300042606 | Bacteria | 1411 |
| 29 | Ga0466721_355107 | 3300042608 | Bacteria | 1198 |
| 30 | Ga0466722_141657 | 3300042609 | Bacteria | 8529 |
| 31 | Ga0466698_098263 | 3300042610 | Bacteria | 2603 |
| 32 | JGI24702J35022_10000742 | 3300002462 | Bacteria | 20088 |
| 33 | JGI24702J35022_10023543 | 3300002462 | Bacteria | 3329 |
| 34 | JGI24702J35022_10031378 | 3300002462 | Bacteria | 2848 |
| 35 | Ga0068305_11122645 | 3300005083 | Bacteria | 1003 |
| 36 | Ga0072941_1094013 | 3300005201 | Bacteria | 9449 |
| 37 | Ga0102740_1004012 | 3300007140 | Bacteria | 3005 |
| 38 | Ga0466733_059229 | 3300042659 | Bacteria | 36946 |
| 39 | Ga0123357_10176297 | 3300009784 | Bacteria | 2512 |
| 40 | Ga0123356_10049356 | 3300010049 | Unclassified | 3917 |
| 41 | Ga0123356_11126870 | 3300010049 | Bacteria | 952 |
| 42 | Ga0123353_10056133 | 3300010167 | Unclassified | 6303 |
| 43 | Ga0123353_10092277 | 3300010167 | Bacteria | 4878 |
| 44 | Ga0123353_10545588 | 3300010167 | Bacteria | 1674 |
| 45 | Ga0123354_10145810 | 3300010882 | Unclassified | 2898 |
| 46 | Ga0160444_100406 | 3300012841 | Bacteria | 21816 |
| 47 | Ga0160448_100163 | 3300012854 | Bacteria | 30313 |
| 48 | Ga0466657_083553 | 3300042582 | Unclassified | 16962 |
| 49 | Ga0466657_327781 | 3300042582 | Bacteria | 1979 |
| 50 | Ga0466690_408805 | 3300042590 | Unclassified | 5520 |
| 51 | Ga0466693_340311 | 3300042592 | Bacteria | 1917 |
| 52 | Ga0466729_318575 | 3300042621 | Bacteria | 3288 |
| 53 | Ga0466703_345055 | 3300042636 | Bacteria | 10006 |
| 54 | Ga0466709_416371 | 3300042648 | Bacteria | 3642 |
| 55 | Ga0466708_301694 | 3300042652 | Bacteria | 11918 |
| 56 | Ga0466725_191900 | 3300042654 | Bacteria | 2261 |
| 57 | Ga0466727_137609 | 3300042655 | Bacteria | 15927 |
| 58 | Ga0466727_209810 | 3300042655 | Bacteria | 1059 |
| 59 | Ga0466716_494356 | 3300042605 | Bacteria | 3044 |
| 60 | Ga0072941_1077030 | 3300005201 | Bacteria | 8650 |
| 61 | Ga0102739_1005814 | 3300007095 | Unclassified | 3645 |
| 62 | Ga0102734_1000029 | 3300007129 | Bacteria | 68380 |
| 63 | Ga0123357_10000005 | 3300009784 | Bacteria | 295874 |
| 64 | Ga0123357_10001915 | 3300009784 | Bacteria | 22651 |
| 65 | Ga0123355_10551839 | 3300009826 | Bacteria | 1393 |
| 66 | Ga0123356_10058150 | 3300010049 | Bacteria | 3605 |
| 67 | Ga0466692_005110 | 3300042591 | Bacteria | 6672 |
| 68 | Ga0466691_209335 | 3300042593 | Bacteria | 25069 |
| 69 | Ga0466694_021039 | 3300042594 | Bacteria | 1419 |
| 70 | Ga0466731_102560 | 3300042622 | Bacteria | 1792 |
| 71 | Ga0466734_015756 | 3300042623 | Bacteria | 28187 |
| 72 | Ga0466735_213234 | 3300042624 | Unclassified | 2711 |
| 73 | Ga0466708_096576 | 3300042652 | Bacteria | 7680 |
| 74 | Ga0466708_117775 | 3300042652 | Bacteria | 15479 |
| 75 | Ga0466725_461929 | 3300042654 | Bacteria | 22391 |
| 76 | Ga0466710_336951 | 3300042613 | Bacteria | 1196 |
| 77 | Ga0466711_145003 | 3300042615 | Bacteria | 32111 |
| 78 | Ga0466711_384879 | 3300042615 | Bacteria | 8015 |
| 79 | Ga0466726_214965 | 3300042619 | Bacteria | 31160 |
| 80 | Ga0466701_076559 | 3300042598 | Bacteria | 1320 |
| 81 | Ga0466713_091546 | 3300042602 | Bacteria | 18477 |
| 82 | Ga0466713_109624 | 3300042602 | Bacteria | 13785 |
| 83 | Ga0466717_249419 | 3300042604 | Bacteria | 1064 |
| 84 | Ga0466716_353952 | 3300042605 | Bacteria | 6349 |
| 85 | Ga0466719_157184 | 3300042606 | Bacteria | 16488 |
| 86 | CVPL010W_10002681 | 3300002931 | Bacteria | 20768 |
| 87 | Ga0072941_1201580 | 3300005201 | Bacteria | 6589 |
| 88 | Ga0103263_100016 | 3300007042 | Unclassified | 51420 |
| 89 | Ga0102736_1000002 | 3300007052 | Bacteria | 204958 |
| 90 | Ga0102735_1000153 | 3300007080 | Unclassified | 18167 |
| 91 | Ga0102734_1001013 | 3300007129 | Bacteria | 7337 |
| 92 | Ga0102737_1000003 | 3300007142 | Bacteria | 215134 |
| 93 | Ga0103268_1004266 | 3300007192 | Unclassified | 5676 |
| 94 | Ga0123357_10181051 | 3300009784 | Bacteria | 2461 |
| 95 | Ga0123356_10001847 | 3300010049 | Unclassified | 22947 |
| 96 | Ga0160443_100762 | 3300012848 | Bacteria | 16635 |
| 97 | Ga0466694_332318 | 3300042594 | Bacteria | 3624 |
| 98 | Ga0466735_010940 | 3300042624 | Bacteria | 1746 |
| 99 | Ga0466702_383710 | 3300042635 | Bacteria | 2647 |
| 100 | Ga0466703_060848 | 3300042636 | Bacteria | 8939 |
| 101 | Ga0466703_320420 | 3300042636 | Bacteria | 23900 |
| 102 | Ga0466704_195288 | 3300042643 | Bacteria | 25757 |
| 103 | Ga0466704_484758 | 3300042643 | Bacteria | 1854 |
| 104 | Ga0466710_416897 | 3300042613 | Bacteria | 23309 |
| 105 | Ga0466715_301330 | 3300042616 | Unclassified | 2381 |
| 106 | Ga0466715_438666 | 3300042616 | Bacteria | 23685 |
| 107 | Ga0466723_020620 | 3300042618 | Bacteria | 11703 |
| 108 | Ga0466726_004930 | 3300042619 | Bacteria | 4794 |
| 109 | Ga0466726_129712 | 3300042619 | Bacteria | 4300 |
| 110 | Ga0466728_181251 | 3300042620 | Bacteria | 18833 |
| 111 | Ga0466729_059828 | 3300042621 | Bacteria | 4892 |
| 112 | Ga0466717_185559 | 3300042604 | Unclassified | 6720 |
| 113 | Ga0466719_112619 | 3300042606 | Bacteria | 9806 |
| 114 | Ga0466719_126414 | 3300042606 | Bacteria | 59815 |
| 115 | Ga0466722_023964 | 3300042609 | Bacteria | 4449 |
| 116 | DPOL_contig13718 | 2035918003 | Unclassified | 2366 |
| 117 | JGI24695J34938_10001235 | 3300002450 | Bacteria | 22520 |
| 118 | Ga0103260_1000020 | 3300007139 | Bacteria | 70191 |
| 119 | Ga0466705_211599 | 3300042612 | Bacteria | 21797 |
| 120 | Ga0123353_10081105 | 3300010167 | Bacteria | 5217 |
| 121 | Ga0123354_10008853 | 3300010882 | Bacteria | 15351 |
| 122 | Ga0160472_101326 | 3300012839 | Bacteria | 7578 |
| 123 | Ga0160444_101224 | 3300012841 | Bacteria | 5531 |
| 124 | Ga0160444_108443 | 3300012841 | Unclassified | 1296 |
| 125 | Ga0466656_229157 | 3300042550 | Bacteria | 2440 |
| 126 | Ga0466657_199190 | 3300042582 | Bacteria | 1994 |
| 127 | Ga0466690_149138 | 3300042590 | Bacteria | 14715 |
| 128 | Ga0466690_321140 | 3300042590 | Bacteria | 25918 |
| 129 | Ga0466695_302721 | 3300042595 | Bacteria | 1621 |
| 130 | Ga0466735_036021 | 3300042624 | Unclassified | 3046 |
| 131 | Ga0466704_405583 | 3300042643 | Bacteria | 15459 |
| 132 | Ga0466725_164280 | 3300042654 | Bacteria | 17642 |
| 133 | Ga0466725_185939 | 3300042654 | Bacteria | 36509 |
| 134 | Ga0466710_038761 | 3300042613 | Bacteria | 64329 |
| 135 | Ga0466729_084932 | 3300042621 | Bacteria | 104590 |
| 136 | Ga0466729_147343 | 3300042621 | Unclassified | 5823 |
| 137 | Ga0466701_090267 | 3300042598 | Bacteria | 1675 |
| 138 | Ga0466700_152425 | 3300042600 | Bacteria | 1352 |
| 139 | Ga0466707_106169 | 3300042601 | Bacteria | 14657 |
| 140 | Ga0466707_175120 | 3300042601 | Bacteria | 20435 |
| 141 | Ga0466707_370380 | 3300042601 | Unclassified | 2929 |
| 142 | Ga0466714_026747 | 3300042603 | Bacteria | 1102 |
| 143 | Ga0466716_122748 | 3300042605 | Unclassified | 1541 |
| 144 | Ga0466719_006300 | 3300042606 | Bacteria | 1950 |
| 145 | Ga0466719_486350 | 3300042606 | Bacteria | 13185 |
| 146 | SPBB_contig00432 | 2044078006 | Unclassified | 1635 |
| 147 | JGI24702J35022_10108096 | 3300002462 | Bacteria | 1528 |
| 148 | JGI24705J35276_12237086 | 3300002504 | Unclassified | 9762 |
| 149 | JGI24696J40584_12725565 | 3300002834 | Bacteria | 764 |
| 150 | Ga0105524_104439 | 3300007733 | Bacteria | 6920 |
| 151 | Ga0466697_134872 | 3300042611 | Bacteria | 5929 |
| 152 | Ga0466697_225963 | 3300042611 | Bacteria | 1159 |
| 153 | Ga0123356_10080362 | 3300010049 | Bacteria | 3082 |
| 154 | Ga0123356_10087799 | 3300010049 | Bacteria | 2955 |
| 155 | Ga0123356_11158996 | 3300010049 | Bacteria | 940 |
| 156 | Ga0123353_10115883 | 3300010167 | Bacteria | 4312 |
| 157 | Ga0123353_10267324 | 3300010167 | Bacteria | 2637 |
| 158 | Ga0123353_10843155 | 3300010167 | Bacteria | 1258 |
| 159 | Ga0123353_11352561 | 3300010167 | Bacteria | 920 |
| 160 | Ga0466656_308387 | 3300042550 | Bacteria | 1473 |
| 161 | Ga0466657_315176 | 3300042582 | Unclassified | 4246 |
| 162 | Ga0466657_328956 | 3300042582 | Bacteria | 1972 |
| 163 | Ga0466690_206122 | 3300042590 | Bacteria | 1375 |
| 164 | Ga0466692_128697 | 3300042591 | Bacteria | 29218 |
| 165 | Ga0466696_042576 | 3300042596 | Bacteria | 13410 |
| 166 | Ga0466731_136842 | 3300042622 | Bacteria | 1915 |
| 167 | Ga0466734_013970 | 3300042623 | Bacteria | 6316 |
| 168 | Ga0466735_222479 | 3300042624 | Unclassified | 4117 |
| 169 | Ga0466703_276609 | 3300042636 | Bacteria | 60964 |
| 170 | Ga0466708_164450 | 3300042652 | Bacteria | 37163 |
| 171 | Ga0466710_211598 | 3300042613 | Bacteria | 14971 |
| 172 | Ga0466715_044730 | 3300042616 | Bacteria | 7240 |
| 173 | Ga0466723_233813 | 3300042618 | Bacteria | 18111 |
| 174 | Ga0466701_025535 | 3300042598 | Bacteria | 249043 |
| 175 | Ga0466706_230345 | 3300042599 | Bacteria | 3696 |
| 176 | Ga0466707_000724 | 3300042601 | Bacteria | 26529 |
| 177 | Ga0466713_010828 | 3300042602 | Bacteria | 3416 |
| 178 | Ga0466722_221140 | 3300042609 | Bacteria | 3560 |
| 179 | Ga0068305_10048834 | 3300005083 | Bacteria | 7524 |
| 180 | Ga0068305_10277852 | 3300005083 | Bacteria | 15502 |
| 181 | Ga0103265_1001450 | 3300007068 | Unclassified | 3845 |
| 182 | Ga0103268_1000831 | 3300007192 | Bacteria | 8628 |
| 183 | Ga0466705_144704 | 3300042612 | Bacteria | 26960 |
| 184 | Ga0123356_10054828 | 3300010049 | Unclassified | 3712 |
| 185 | Ga0123353_10426012 | 3300010167 | Bacteria | 1964 |
| 186 | Ga0123354_10002575 | 3300010882 | Bacteria | 24153 |
| 187 | Ga0123354_10037100 | 3300010882 | Unclassified | 7590 |
| 188 | Ga0160446_108407 | 3300012835 | Unclassified | 1364 |
| 189 | Ga0160430_100531 | 3300012852 | Bacteria | 20613 |
| 190 | Ga0160457_1000003 | 3300012858 | Bacteria | 1020748 |
| 191 | Ga0160457_1000027 | 3300012858 | Bacteria | 297202 |
| 192 | Ga0466691_156291 | 3300042593 | Bacteria | 26465 |
| 193 | Ga0466734_014035 | 3300042623 | Bacteria | 2820 |
| 194 | Ga0466734_076859 | 3300042623 | Bacteria | 25073 |
| 195 | Ga0466709_418632 | 3300042648 | Bacteria | 47357 |
| 196 | Ga0466708_032942 | 3300042652 | Bacteria | 36683 |
| 197 | Ga0466712_182347 | 3300042614 | Bacteria | 11394 |
| 198 | Ga0466711_109307 | 3300042615 | Bacteria | 29995 |
| 199 | Ga0466715_140159 | 3300042616 | Bacteria | 9478 |
| 200 | Ga0466718_040435 | 3300042617 | Unclassified | 2919 |
| 201 | Ga0466723_044796 | 3300042618 | Bacteria | 3114 |
| 202 | Ga0466726_137556 | 3300042619 | Bacteria | 24871 |
| 203 | Ga0466722_196355 | 3300042609 | Bacteria | 12120 |
| 204 | JGI24702J35022_10059009 | 3300002462 | Bacteria | 2050 |
| 205 | Ga0072940_1285930 | 3300005200 | Bacteria | 2663 |
| 206 | Ga0103263_100611 | 3300007042 | Unclassified | 4866 |
| 207 | Ga0103264_1030278 | 3300007188 | Unclassified | 3416 |
| 208 | Ga0123357_10000387 | 3300009784 | Bacteria | 41806 |
| 209 | Ga0466705_129008 | 3300042612 | Bacteria | 16819 |
| 210 | Ga0466705_146331 | 3300042612 | Bacteria | 2057 |
| 211 | Ga0123353_10086533 | 3300010167 | Bacteria | 5047 |
| 212 | Ga0123354_10228630 | 3300010882 | Bacteria | 1952 |
| 213 | Ga0160441_118042 | 3300012825 | Unclassified | 710 |
| 214 | Ga0264413_155874 | 3300024493 | Bacteria | 2120 |
| 215 | Ga0466690_406175 | 3300042590 | Bacteria | 69346 |
| 216 | Ga0466696_014827 | 3300042596 | Bacteria | 4965 |
| 217 | Ga0466703_054390 | 3300042636 | Bacteria | 2587 |
| 218 | Ga0466704_113734 | 3300042643 | Bacteria | 2591 |
| 219 | Ga0466709_095292 | 3300042648 | Bacteria | 2816 |
| 220 | Ga0466709_110263 | 3300042648 | Bacteria | 16303 |
| 221 | Ga0466708_215602 | 3300042652 | Bacteria | 15739 |
| 222 | Ga0466725_017039 | 3300042654 | Bacteria | 50096 |
| 223 | Ga0466727_335351 | 3300042655 | Bacteria | 67580 |
| 224 | Ga0466715_227324 | 3300042616 | Bacteria | 3888 |
| 225 | Ga0466715_266137 | 3300042616 | Bacteria | 6088 |
| 226 | Ga0466726_032824 | 3300042619 | Bacteria | 12093 |
| 227 | Ga0466726_188842 | 3300042619 | Bacteria | 15083 |
| 228 | Ga0466726_406694 | 3300042619 | Bacteria | 19448 |
| 229 | Ga0466701_047855 | 3300042598 | Bacteria | 5972 |
| 230 | Ga0466719_055618 | 3300042606 | Bacteria | 10384 |
| 231 | Ga0466722_136888 | 3300042609 | Bacteria | 17058 |
| 232 | Ga0466697_056039 | 3300042611 | Bacteria | 2886 |
| 233 | CVPL010W_10097410 | 3300002931 | Unclassified | 889 |
| 234 | Ga0103265_1004938 | 3300007068 | Unclassified | 1869 |
| 235 | Ga0103267_1004199 | 3300007190 | Unclassified | 3910 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01479 | GO:0003723 | RNA binding | MF |
| PF00163 | GO:0019843 | rRNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.